SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002247 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002247
Domain Number 1 Region: 369-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 410-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000442
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 241-249
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002247   Gene: ENSACAG00000002338   Transcript: ENSACAT00000002307
Sequence length 487
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343210.1:3187650:3200155:1 gene:ENSACAG00000002338 transcript:ENSACAT00000002307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSASLETVLPSACSVRSAAPSSSSSSSSSSSSSSSNPAKTLAFSIERIMAKSSAPAPA
FEARPRGPSPPLLPPKKLLGLGPPLPCVVPLPGYDPPPNKALMNYSELWKSSLRSCGSSA
LGGGGGGFCKGLCCKDPHPHHRHHHHHHHLPAPLPPPRVIKPQVIHQSLSAPANGSSLYY
FNYLEASSYPPSELLFTSGLLHPQSAAAAAAAAAAAALSAHQKLFLLENAKLAALGPPPP
PPPPPPPPPPPPEKYPSAHYPHKERLPGQLDQVMKENLGGGERHGLKGHQGGGGGTPDGK
PKNFTCEVCGKVSKRMDGCDSKQDRYAGFQISFHKITSRTLLKCLGLCDIKIIMLQEKPH
KCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTI
CNKAFHQIYNLTFHMHTHNDKKPFTCLTCGKGFCRNFDLKKHVRKLHDPSAAPLSSTKEL
TRTGPPS
Download sequence
Identical sequences H9G654
ENSACAP00000002247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]