SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002260 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002260
Domain Number 1 Region: 494-499,566-955
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.62e-99
Family Formin homology 2 domain (FH2 domain) 0.00000306
Further Details:      
 
Domain Number 2 Region: 2-363
Classification Level Classification E-value
Superfamily ARM repeat 5.76e-96
Family Diap1 N-terninal region-like 0.0000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002260   Gene: ENSACAG00000002222   Transcript: ENSACAT00000002320
Sequence length 1032
Comment pep:known_by_projection chromosome:AnoCar2.0:1:247088005:247210475:1 gene:ENSACAG00000002222 transcript:ENSACAT00000002320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDELDLTDKNREAMFALPPEKKWQIYCSKKKEQEDPNKLATSWPDYYIDRINSMAAMQT
VYAFDEEETEMRNKIVEDLKTALRTQPMRFVTRFIELDGLTCLLNFLKSMDYETSESRIH
TSVIGCIKALMNNSQGRAHVLAHPESINIISQSLRTENIKTKIAVLEILGAVCLVPGGHK
KVLQAMLHYQVYAAERTRFQSLLNELDRSMGQYRDEVNLKTAIMSFINAVLNAGTGEDNL
EFRLHLRYEFLMLGIQPVIDKLRGHENATLLQRHLDFFEMVRNEDDLELAKRFEVVHIDT
KSASQMFEMIKKRLKHTDAYPYLLSVLQHCLQMPYKRSGGTFQKWQLLDRILQQIVLQDE
RGDDPDIAPLENFNVKNIIKMLVNENEVKQWRDQAEKFRKEHAELMSRLEKKERECEIKT
QEKDEMMKTLNKMKDKLQKESLELRQTRDQMTDLVTQINEFSQGGSISFQPPPQLPPGGP
FALPSSLPSSDSLPPPPPPLPFSSCPPPPAPPPPPGGPPPPPGAPPCFNMGIPPLSSTTT
FSSSSSSGTSLKKKSIPQPSHPLKSFNWSKLNEEKIHGTIWHEIDDLRAFKMLDLEDFEK
MFSAYQRHQVSYLNVTRNKEMGSTEDLYLSSRKVKELSVIDGRRAQNCVILLSKLKLSNE
EIRQAILKMDEEEDLAKDMLEQLLKFVPEKSDIDLLEEHKHEIDRMARADRFLYEMSRID
HYQQRLQALFFKKKFPERLAEAKPKVEAILLASKELVRSKHLKQLLEVVLAFGNYMNKGQ
RGNAYGFKVSSLNKIADTKSSIDKNITLLHYLIMIFEKNYLDILDIQSELQYLPEAAKVN
LVELEKEVNNIKAGLKAVEAELEYQKRRVREAGDRFVPVMSDFITVASFSFSELEDLLND
ARDKYTKALKHFGENEGRMQPDEFFGIFDTFLQSFTEAKQDLENMRKKKEEEERRARMEA
MLKEQREKERRQKKAKAGSISEDGGGEFDDLVSALRSGEVFDKDLKLKRGRKRSGNQNLE
TSRERAVTKLNY
Download sequence
Identical sequences G1KAK9
ENSACAP00000002260 ENSACAP00000002260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]