SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002281 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002281
Domain Number 1 Region: 36-89
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000156
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000002281
Domain Number - Region: 1351-1360
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0018
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002281   Gene: ENSACAG00000002372   Transcript: ENSACAT00000002341
Sequence length 1532
Comment pep:known_by_projection chromosome:AnoCar2.0:5:53575412:53608392:1 gene:ENSACAG00000002372 transcript:ENSACAT00000002341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNKNQCLQNGEDEKHEGKEGKENEEDCSCSSSTLPDEGDRCPICLNCLTEQEVGFPENC
SHIFCLTCILKWAETRASCPVDRKQFQAVYKLNALKDCIKVQIKQQVSKKDDLLCCKEGK
YCPMNMKNCTRKQENAEKRNLSAVSGKALNQKHNFSKEGEAKHSVKKNKPRRQTCLNRLI
RGSFHDRFSSNSSFPGESPNYEHERIEISKIDTVIGHKRRELDLSCSMLARMARIPSLCC
DAEMAACLLVSTVIMGTGFSISTTPLENFGSSERGHVVTYVQEGEEKKQTSGTAGTRGSR
RKVSDTTPRRRSARNVKTETLNQSQSSPKSSNSGCEASGDGDSFVNASSEESEKLPPKRK
SKRGVKQQEPLVKKNLRSSGRYRKTSSDEVEVEESDGTKITQLLDKDSLLESANSTSDFG
QKSDAETQSANGLENSKDCVEYKEEPPKDPDEGQDNLDIVDTDSCSQDPPLLTLEGEISS
YSQDPPVLTLEGDSKKCETKDNVYGDTSCYASTVDHVDQPLPNVSSDELCGDTVTFTHQS
KELESPKNELPMHELEPAVITSSSSPTLDSPGGDLLEKSVCVLVAGDIFTAPGNDVPGGA
EFMAITDSSLSDTGNKSPEEQGSMEVPDEPLTCFRNELLRETEPLATEEMFERPGSEISE
RTLSAHSENTLSDGKDFEMVVEEPLDSSTSKLKELPMSLENEDAKAGEEETTAAENRDLD
QENLQGTDILLNISVEEEHEKPVEKINEDSRPDTSSSVCTQEIKHFSEDNTEIVAMECDS
FGSDQNDSQIDQPLMCESLQEEASSLIHDTEHSASLAVLSDKKEETESPTEIKKDKKPRI
RRSRFHSPSTTWSPSKGERKRSQSPSPKREIISESRMSRSPRRDGCKEGQQSLLQSPARD
TVIEEVRSLPGSPKRELADRGSPSTSPKRDLLEEKRSPPSSPKRDAVREERRSPSGSPKR
DPRREGRRSSWIQGKDSSPRHKCRSQSKDRESDKDGLRRDHERERSRRRWSQSRSRSRSR
SRSRTRSKAPSFPRNERDSYSPPRWKERWGNDSWRSPRGNDRYKRNEQEKHAESMKRERD
NINKDGDKQSSSEQYRKDYPDWIMEKINSVPEPRNRETFKNEPWEENRHNNSGPQWNRSF
GSGWNSNRGRGARSRGGRGRGGFPYGEQTENRWQTRKPHSGNADNSGNESSRFTEHQPYK
RKPEQDFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSKRGRNPSSPQSSWTKQEEVAS
EQDPNFKDQGNQQNDNSQLPINVLQPQMNVMTPVNTQHQPMNLFPYPMAVPTPIMNIQHN
PFSLPPPVPLHLHSGVPLVQVAASASVSQGPPPPPPPPPPSQQINYVTSQPDGKQLQAIP
STSHIANNMSTSLLPASAATLGSVETVQGPSSGNATSSSNTKTSNAAIKLAESKVSVTVE
ASADSSKKDQKLLIQEKAAQEVKLAIKPFYQNKDITKEEYKEIVRKAVDKVCHSKSGEVN
SAKVANLVKAYVDKYKHSRKKNPDEAVSVERK
Download sequence
Identical sequences G1KAM0
ENSACAP00000002281 XP_008109300.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]