SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002567 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002567
Domain Number 1 Region: 43-179
Classification Level Classification E-value
Superfamily Cupredoxins 7.3e-53
Family Ephrin ectodomain 0.000000225
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000002567
Domain Number - Region: 2-12
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002567   Gene: ENSACAG00000002604   Transcript: ENSACAT00000002632
Sequence length 344
Comment pep:known_by_projection chromosome:AnoCar2.0:3:103536017:103608063:-1 gene:ENSACAG00000002604 transcript:ENSACAT00000002632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPLPPPPPPARRGAPSPLGRCCWALWVLLCRTALASSLVLEPIYWNSSNSKFHPGQG
LVLYPKIGDKLDIICPKVDSKTGGQYEYYKVYMVDKDQADSCTIKKDNTPLLNCAKPDQD
VKFTIKFQEFSPNLWGLEFQRNKDYYIISTSNGSLEGLDNQEGGVCLTKAMKILMKVGQV
PNSGGSPNNADPTKRPEQEAGTNGKSSTTSPFVKDHAGSNSDGNKAGHTSILGTEVALFA
GIASGSIIFLIIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDI
IIPLRTADNVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Download sequence
Identical sequences G1KAZ8
ENSACAP00000002567 XP_003218789.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]