SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003167 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003167
Domain Number 1 Region: 16-146
Classification Level Classification E-value
Superfamily Bromodomain 2.35e-42
Family Bromodomain 0.00024
Further Details:      
 
Domain Number 2 Region: 303-429
Classification Level Classification E-value
Superfamily Bromodomain 2.62e-42
Family Bromodomain 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000003167
Domain Number - Region: 217-226
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003167   Gene: ENSACAG00000003200   Transcript: ENSACAT00000003248
Sequence length 756
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343736.1:32014:70163:1 gene:ENSACAG00000003200 transcript:ENSACAT00000003248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVASATQAPQGPANPPPPEVTNPAKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVD
AIKLNLPDYHKIIKNPMDMGTIKKRLEHNYYWSASECMQDFNTMFTNCYIYNKPTDDIVL
MAQALEKIFLQKVAQMPQEEVELLPPVPKGKARKAATTAHNAGAQHPATTAVSSVSPPAP
FQNVPPSVSQTPVIAVTPMPTITPTIAPIATPPATVPPPPPPPPPPAAPIMPVVPPTPPI
VKKKGVKRKADTTTPTTSAITASRSESPTPLLDAKQAKVVARRESGGRPIKPPKKDLEDG
EIPQHAGKKGKLSEHLKYCDSILKEMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPM
DLSTVKKKMDSREYQDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
DEPAEPPPPPPPAAPVVSKSMESSHSSEESSSDSDSSDSEEERATRLAELQEQDCSRSVR
QCYKVNDSRDWNGWNLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKEKHK
VKAAVEEEKKAKVAPPAKQAQQKKAPAKKANSTTTANRQPKKGGKQPPATYDSNEEEEGL
PMTYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELE
RYVKSCLQKKQRKPFSASGKKQAAKSKEEMAQEKKKELEKRLQDVSGQLNNNKKPAKKEK
SGSAPSGGPSRLSSSSSSESGSSSSSESSSDSSDSE
Download sequence
Identical sequences H9G794
ENSACAP00000003167 XP_016853707.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]