SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003330 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003330
Domain Number 1 Region: 2157-2370
Classification Level Classification E-value
Superfamily SET domain 1.83e-64
Family Histone lysine methyltransferases 0.00043
Further Details:      
 
Domain Number 2 Region: 2531-2643
Classification Level Classification E-value
Superfamily Bromodomain 4.84e-21
Family Bromodomain 0.0018
Further Details:      
 
Domain Number 3 Region: 2663-2725
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000329
Family PHD domain 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000003330
Domain Number - Region: 387-399
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0157
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003330   Gene: ENSACAG00000003417   Transcript: ENSACAT00000003413
Sequence length 3057
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343519.1:282248:338913:-1 gene:ENSACAG00000003417 transcript:ENSACAT00000003413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQNTAMLGLGSGSEGFSGKSPSAVATGTAGGRREVELDGSTKEDEEDNRSCEGTAGDE
AGKDERVTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTTTRR
VQKVGKMPEEKNDPGPVKQDPAKLYKKGGEATPIVEGSTADGRLRESSLLSRKLSPLRSE
VKDYGKSALSTPIPNHDPDSKDRIQINGTPTVTEKLAQLIATCPPSKSSKTKQKKLPMGI
ATGFAKDSGKKLPVVVAPSALAIKDFVKKQPGSSSVGVALSNKEFAKKSPGTAVGIGLIS
KDSGGKKQPGICPNMVGLTGKDCGRKIPILSSPVGLVSKESGRTSLVTGTPLGLISKEPG
KRLLGAGSPVGLVNKDPVKKLLNAVSPPPPPPPPPPLVNKDSGKKLPGPGNPIGLFNKNS
EKKHSGSEGPTGLISKESGKKLPGFNTTSGLVNKDSGKKLLGASGLVTKESGRKPLGIGG
PPALSGKDSGKRLVGTSSPCTLANKDSGSLKTDLASSSSEPYKRCCGANLLNLESAVPPG
FLKDSVGNKPFEKHTARPSKESIPEKLPSQNEVSSGSKEGNSSIQQDGSLSSERVPSETS
KHDKQVPVYCTSPDFRTTGGASDVSTAKSPFSAVGEGGLPSPSPAASVATLIRSPTATLA
QLASSPLHLNNTPDFLEGISEQISKTPFASDSARSSMNRVLNPGSKGFGRELNISGSKPS
QSLGKKPSLGTDSSARATVAPSVVSFSSLFNNKPFLKMGTMTASGKACQGVESLSSGCSP
QTKPFKKRKGRKPRWTKVVSRSTCQPSKGLELGRPELFGNISCSSLSNSSLDQTKLFKSS
GPLSYAERDFAKHHLPKLSKASSMQSLALLKGVEKEPSKYYSAHMQAPVECIPDDLLPEM
YQSKRGRSKSKEMPHLEGPPKRTLKIPASKVFSVQSKEEQEPPVLHPEVEITSFRQSLLE
EAFPKKRGRPKRQMRSEVKMQPPVLSVAPFVTAESSEKLESDSEQQLSGDFFEEDNPLGG
SEELGKTSDLEGEPDRKETRRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSAAEPNKG
KVQSKLQTTVSTLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKAVLNDILAGNSGGLIV
LEKSTQQAPGTTLGPAILPLLPSVASNSNPEVLPSPVCSQSSGVSGGQSPISSDMSFVEP
NSVPYLHLHSRQGSVVQTLAMRKASRARRRLSPPTLLPNSPSHMSELGSLKEATPSPISE
SHSDETIPSDSGIGTDNNSTSDRAEKFCGPKKRRHSFDHISLVPPETSTVLSSLKEKHKH
KCKRRSHDYLAYDKIKRQKRKRKKKYPQLRGRQDPDFLAELEELINRLSEIRITHRSHHF
IPRDLLPTIFRINFNSFYTHPTFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLS
FPLSSTGFYPSYGMPYSPSPLAAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHTG
HLLLNPAKYHKKKHKLLRQEAFLTASRAPLLSMSTYHPSVPPEMAYGWMLEHKHRHRHKH
REHRSSEQQQVSLDTLAPNGPSRTVLESLKRYRFGKEGVGERYKHKDKHRCHMACPHLSP
SKGLLGREEQWVRREPAESNSLALGLQTPLQIECSDVPPSLPLGRFTPSSEPASSDEHTN
LFTSAIGSCRVAGSASSGGRKKMSDVTGLFGPQETSLGRALRKETLSSGEKTVPVLSAGI
LPAQDKPLQRSTEGTGCSPSRKRSSSESTSSTVTGVPARNTKLGPAVEDPVDNLLQRMAQ
HESQSVLEKTFENMASVPAAPSGSPCQSPSREKNGALLMPGDSGNDDLSLLSNRLSSGYS
PHHFKRSVVEAMQCQARKMYNYDKILATKRNLDHVNKILKAKKLQRQARTGNNFVKRRPG
RPRKYPLPSVVSSHVLQMNRFLSQELESTDQGYLLHRGPDTVKDAIESVVQGVNVKGWKR
KRWQEEEQARKRQKPLPEDEEQSNKRLFLSPELWKRWHRNNNDDDDDNNNNTHKESFSEV
ATESPTREEVIVKPHELETLEQPLISPVQREKKAPRPPKKKYQKAGLYSDVYKTTDPKSR
LIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLRQKRIDFQLPYDILWQWKHNQLYKKPDVP
LYKKIRSNVYVDVKPLSGYEATTCNCKKPEDSNKKGCVDDCLNRMIFAECSPNTCPCGEH
CCNQRIQRHEWVQCLERFRAEEKGWGIRTKESLKAGQFIIEYLGEVVSEQEFRNRMIEQY
HNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCNPNCEMQKWSVNGVYRIGLYALKDMPA
GTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNGLLSKSNQLVSAQRRPSRSK
EKRKSKHKLKKRKGHASEEPSESSSTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEK
IRQKQEEVKHSSDHIHSASLYTRWNGMCRDDGNIKSDVFMTQFSALQTARSVRTRRLAAA
EENLEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDL
TTIEKQILIGYYKTVEAFDGDMLKVFRNAEKYYGRKSPIGRDVCRLRKAYYNARHEAAAQ
IDEIVGETASEADSSETSMCEKENGHEKDEDVIRCICGLFKDEGLMIQCDKCMVWQHCDC
MGVNSDVEHYLCEQCDLRAVDREVPMIPRPHYAQSGCVYFICLLRDDLLLRQGDCVYLMR
DSRRTPDGHPVRQSYRLLSHINRERLDIFRIEKLWKNEKGERFAFGHHYFRPHETHHSPS
RKFYHNELLRVPLYEIIPLEAVVGTCCVLDLYTYCKGRPKGVKELDVYICDYRLDKSAHL
FYKIHRNRYPVCTKTYAFDHFPKRLTPKRDFSPHYIPDNYKRNGGRSAWKSDRAKSQSKD
LCQEEDPLPLMEDMMVGQEVASGEQGPDLEEPEKEAPPQESSEAEKKEEESSPIPRRPCT
PEERRHMQRERLNQILLTLLEKIPGKNAIDVTYLLEEGSGRKLRRRTLALPEGSFRK
Download sequence
Identical sequences H9G7I0
XP_008119254.1.98722 ENSACAP00000003330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]