SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003529 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003529
Domain Number 1 Region: 119-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-44
Family SPRY domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000003529
Domain Number - Region: 47-61
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 4-69
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000863
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003529   Gene: ENSACAG00000003604   Transcript: ENSACAT00000003617
Sequence length 687
Comment pep:known_by_projection chromosome:AnoCar2.0:4:57091947:57130816:-1 gene:ENSACAG00000003604 transcript:ENSACAT00000003617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQQQQQQQPPPPATAPPPPPPPPPPPPPQAPGHTGPSPSSLLLHPPPPPPATSAPPPP
PPPSSASSSSSSSMAAGSGAPSDIPHVGGVGVGADPALNEQEKELQRRLKRLYPAVDEAE
TPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIV
SKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIG
CCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYM
REWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELA
SIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFALKVRQFIEMVNGTDSEVRC
LGGHSPKSQDSYPVSPRSFSSPSMSPSHGMNIHSLATGKGSSTHCSGFESSCSNGVISNK
VHQSYCHSKHQSTSLNVPELNNINVTRSQQVNSYSSNDVDMETDHYSNGVAETSSNGFLN
GSSKHDHEMEECDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRECGKNT
ANKKMLKDAFSLLAYSDPWSSPVGNQLDPIQREPVCSVLNSAILETHNLPKQPPLALAMG
QASQCLGLMARSGIGSCAFATVEDYLH
Download sequence
Identical sequences G1KC27
XP_003219835.1.98722 ENSACAP00000003529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]