SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003593 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003593
Domain Number 1 Region: 1072-1077,1131-1453
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.97e-84
Family Formin homology 2 domain (FH2 domain) 0.000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003593   Gene: ENSACAG00000003646   Transcript: ENSACAT00000003681
Sequence length 1454
Comment pep:known_by_projection chromosome:AnoCar2.0:1:216898423:217140654:-1 gene:ENSACAG00000003646 transcript:ENSACAT00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNQDGKLKKNAGDAHDGGEDASGPRDADGTKKGAGSKKGLGKHSKGNESGKKKGKSESR
GSVFSNLRIRKNLSKAKDGNSSSREDVLESQASQTGELDSAHSILTKTPDISISADEGGL
SDTDVEHFEHTNETRPAAAEPQDGQRTSSGSDTDIYSFHSATEQEDLLSDIQQAIRLQLQ
QQQGAINSGTEQHGTKTMGLHMANSQAAPFDFERFLSLSSDKDSSPEMEQPVSAKSEITD
YIPASDIESGVKEVTNGIGHSCSSVFDVQEERRSVFNFPSPIGESETEVSAFEFSGSERE
EEDIANTSHNQVEGAKERKRSISASREALDDGFSATIKNGTLSSNDVSSSPMHSSKGLKP
FPPINPCYIKTTTRQLSSPNHSPCLSPSQSPLFKRRRESTQRKENVPTKKQRASSLAGPF
SRSADWTVTLSTQTPERGRQMTRLARAAQASASKGVPPQPALPAPEGVPAEYGEFSDVFL
GRTLLEKLSCQQENAPQEEAEKICSWIIAMGLLLPFSDCFREPCGGQSAQQSAPTFDQDQ
LYTWAAVNQPTHSSDYIEGRFPGRIPSVWPPPKPPDEEQRIKHKEPDPTLSPLKGIQSCL
IGIQEDVIIKSEERASEIQRLEQTIQDLKIKIAELEKQFPASEVLVSSSNQRESGQTTCE
ELFSAGLEEQELQTLPKTITAKSVQTSPTDDCLIHTMPSASTLPQAPPLLKGNVSQGPTQ
LLPTLEPQTTFCSELSLVLSPKQISLQLDDVQEKLTGLQISGPDANFPPLLQEQPVSSTA
LSTESFTCSEASPSLSSHPVLESHPGLSDTGVSPSLPGAGVPFVMPPSPSSGVPLPLAPF
SSGHALSSLPAPLLPSGGIPPPPPLPGMDMAPPPPPPLPAAVMPTEIPPPPPLPDMGVPL
PTSLPGATVPLAPSLPGMSMPPAPPPLPDMEVPQPPPLPWTGFSSPHLLPGTGIPPPPPP
PPPGIGVSLHPPHLPGMGIPPAPPPLPGMGVPLPPPPPPLPGMWGPPPPPPLPGMGGPPP
PPPPPPLPGMGGPPPPPPPPPLPGMGGPPPPPPLPGMDGPPPPPPLPGAGPPPPPPPLPG
MGVPPPPPISLPHGSGFLPPPLPSGLFVMGMNQEKGSRKHAIEPSRPMKPLYWTRIQLHN
KRDSSASLVWEKIEEPSIDYHEFEELFSKTAVKERKKPISDTITKTKNKQVVKLLSNKRS
QAVGILMSSLHLDMKDIQHAVVNLDNSVVDLETLQALYENRAQSDELEKIEKHGKSSKEK
ENAKSLDKPEQFLYELSLIPNFSERVFCILFQSTFSESISSIRSKLELLQKLCETLKSGS
GVMRVLGLVLAFGNYMNGGNRTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRN
FDEDAGKEQCIFPLPEPQDLFQASQLKFEEFQKDLRKLKKDLKACETEAGKVCQFSLEEH
IQPFKDNMEKFISQ
Download sequence
Identical sequences G1KC54
ENSACAP00000003593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]