SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003991 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003991
Domain Number 1 Region: 186-386,435-451
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.79e-34
Family WD40-repeat 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000003991
Domain Number - Region: 66-139
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003991   Gene: ENSACAG00000004089   Transcript: ENSACAT00000004083
Sequence length 647
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343962.1:60033:70182:1 gene:ENSACAG00000004089 transcript:ENSACAT00000004083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALAPPAQDGGPTPTPPPQQQQPPYEVKSQFRTREGSYRLLGAPEPRTRPAGAATPSS
SAAPPPPPPPPSSASGGAPPPPPPPAPSLPPVRLSLVRLNSSSGGGGGGGGDPGGEGDPG
ALAAERSRVCFNLGRELYFYSGSGGAPGRGRRSIDLKKPIDKRIYKGTQPTCHDFNQFTA
ASETISLLVGFSAGQVQYLDLIKKDTTKLFNEERLIDKTKVTYVKWIPETESLFLASHAS
GHLYLYNVEHPCGSASPQYTLLKQGEGFTVYGCKSKSARNPLLKWAVGEGALNEFAFSPD
GRYLACVSQDGCLRVFHFDSMLLQGMMKSYFGGLLCVCWSPDGRYIVTGGEDDLVTVWSF
AEGRVIARGHGHKSWVNAVAFDPFTTSTEDDGSGEFSGSDEDIQETSNFGRVRTSSTLSH
LSKHSTKSTPSVTYRFGSAGQDTQFCLWDLTEDVLYPHHPLSRARTLTNTFSAGIPPSGS
GGSNLAAESTGGGALPRSLSRSNSLPHPAVTSAAKSHVADGVVPFSIGKFATLTLQERKE
KNAEKEHKRYHSLGNISKSNDKLNVVPKSKLDTAKVLGTALCPRINEVPLLEPLICKKIA
HERLTVLLFLEDCIITACQEGLICTWARPGKATLNSQNGGSPSGTVV
Download sequence
Identical sequences H9G8I1
ENSACAP00000003991 XP_008121856.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]