SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004788 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004788
Domain Number 1 Region: 648-656,712-1091
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.4e-99
Family Formin homology 2 domain (FH2 domain) 0.00000000377
Further Details:      
 
Domain Number 2 Region: 50-409
Classification Level Classification E-value
Superfamily ARM repeat 2.94e-98
Family Diap1 N-terninal region-like 0.0000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004788   Gene: ENSACAG00000004603   Transcript: ENSACAT00000004896
Sequence length 1165
Comment pep:known_by_projection chromosome:AnoCar2.0:3:75602478:75660587:-1 gene:ENSACAG00000004603 transcript:ENSACAT00000004896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKFSSIRIPGSKKERPILPNMKQSDSSIGDWPLSADVDSFIPTPLTDAEILALFEKMMED
MNLNEDRKAPLREKDFSTKKEMVMRYMDTASKVGSFKSNKQISPQEFIYELKTGTADEKL
ISCLESLRVSLTSNPVSWVENFGHEGLGLLLDTLERLVETKHQDKILKKVQHKIIQCLKA
FMNNKYGLERIMGEQRSFSLLAKTIDPRQVNMMTDVAKLLSAICIVGEENILEKILEALT
TVAEEKNTDRFFPIVEGLRGNSVHLQIACMQLINALVTSPDDLDFRLHIRNEFMRCGLKE
QLPQLKCINNDALDIQLRVFSEHKEEDMIEFSHRLGDIRILDLITEANDVYNVLWNTIKN
TSAEGSFLSILQHLLLIRNDHCIRPLYFKLIEECISQIVLHRSGIDPDFSYRKRLDVDFS
HILDVCIEQKKIEELEDKASDFSKKFENEFLAHQETKAQLQKIEEKISHLDADQRVHKHK
QISQKVMLTQKKNLETLHYQCFKSSSNKNIIQQHKQASQLGSAPAETPGSEVSIDPKSPD
ISGGCAHSVPASPATTCSSASISPSESSSEDPPYSSLSRFLRNSSSEPSSRGFFLPLRIP
SPSTIIPEGAVTTDGSVTNGTSLESPTHLPQVDATPDLLAPFTGAVPPPPPPPPPPLPAS
FTNGSGKPPLGVPPPPPLPTLSGAQHSPTSRVLPFGLKPKKEFKPEVTMKRLNWSKIRPQ
EMNENCFWILANDSKYENPDLLCKLEHTFSCQKYDSKTKKDDGFEEKKSVKKRIKELKIL
DPKTAQNLSIFLGSFRVPYEQIKTMILEIDEVQLSESMVQNLINHLPEQKQLDELSKLKN
EYNNLSDPEQFAIVMSNVKRLKPRLSAILFKLQFEEQVNNIKPDIMAVSAACEELKKSRS
FSQLLELVLLMGNYMNAGSRNAQSFGFNLCSLCKLKDTKSVDQMTTLLHFLVEICEEKYP
NILKFVADLQHLDKANRVSVESLEKSLKQMEGQLKQLERDLETFPLSEDIHDKFVTKMSI
SFFCQAKQQFQNLSKMHENMEKLYRNIMEYYALDLKKVSVEEFLTDLNNFRTMFMQATKD
NMRRKEAEEKQSRARIAKEKAEKEKLERQENKKRLLEMQTEGDETGVMDSLLEALQSGAA
FRDRRKRTTRFKGKYFFTFLLSTEL
Download sequence
Identical sequences G1KDA5
ENSACAP00000004788 ENSACAP00000004788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]