SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004870 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004870
Domain Number 1 Region: 496-529,584-845
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.66e-56
Family WD40-repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000004870
Domain Number - Region: 233-245
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004870   Gene: ENSACAG00000004931   Transcript: ENSACAT00000004982
Sequence length 900
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343403.1:152301:185988:-1 gene:ENSACAG00000004931 transcript:ENSACAT00000004982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILPARLCWYSRHFPPGQRWEIKLGMKCKELPSGPQTAESEAAMPEVKQDDPKEIIDTIIE
ESQKVNPLEDDPLAVPGQEPTDPSSQANLWISGADLLQNIPELLVAEATLPEDREAPLSE
APVEDETEPGTALPPLVGDTPEYEEGSGVPTEISGEARGPKADGDDEAEGHPVDILASTE
LSPIKDLSAGDDYEEEEVPPSKPPRQLSMEPDIVASTKKTLPARPPPPAGGPPPPPPPSR
PAPPPRKKKSELEIETQTSPGLEVSREAFPGGLLSPHASVDSMAKDSQPSLDLASATSGD
KIVTAQENGKPADGQTVTSEVVGPQRPRSNSGRELTDEEILASVMIKNLDTGEEIPLSLA
EEKLPTGINPLTLHIMRRTKEYVSNEGAQSDDEDKLQSQQSDTDGGRLKQKTTQLKKFLG
KSVKRARHLAEEYGERAVNKVKSVRDEVFHTDQDDPSSSDDEGMPYTRPVKFKAAHGFKG
PYDFEQIKVVQDLSGEHMGAVWTMKFSHCGRLLASAGQDNVVRIWVLKNAFDYFNNMRMK
YNTEGRVSPSPSQESLNSSKSDNDMGVCSGTDEDPDDKNTPFRQRPFCKYKGHTADLLDL
SWSKNYFLLSSSMDKTVRLWHISRRECLCCFQHIDFVTAIAFHPRDDRYFLSGSLDGKLR
LWNIPDKKVALWNEVDGQTKLITAANFCQNGKYAVIGTYDGRCIFYDTEHLKYHTQIHVR
STRGRNRVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKGYVNSSSQIKAS
FSHDFTYIVSGSEDKYVYIWSTYHDLSKFTSVRRDRNDFWEGVKAHNAVVTSAIFAPNPS
LMVSSETSEKPEPDAKSEDSESGDPIPSGALKTDHTEVLLSADFTGAIKVFINKKKAASS
Download sequence
Identical sequences H9G9R4
ENSACAP00000004870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]