SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004964 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004964
Domain Number 1 Region: 58-192
Classification Level Classification E-value
Superfamily dUTPase-like 2.49e-47
Family dUTPase-like 0.000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004964   Gene: ENSACAG00000005059   Transcript: ENSACAT00000005077
Sequence length 197
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343806.1:24610:36072:1 gene:ENSACAG00000005059 transcript:ENSACAT00000005077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSLRRLFGNNFAGVRSPFASPSPALSPAMPCTAEDPVSSPSKRLKASGPEEPLKTLR
FAKLSENAVAPSRGSSKAAGYDLYSAYDYEIPASGKAIVKTDIQIALPTGCYGRVAPRSG
LAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKESFKVKKGDRIAQLICERIYYPELEEVEV
LDETERGSGGFGSTGQK
Download sequence
Identical sequences H9G9U7
ENSACAP00000004964 XP_003229150.2.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]