SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005356 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000005356
Domain Number - Region: 53-62
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005356   Gene: ENSACAG00000005497   Transcript: ENSACAT00000005473
Sequence length 248
Comment pep:known_by_projection chromosome:AnoCar2.0:3:144490791:144501702:-1 gene:ENSACAG00000005497 transcript:ENSACAT00000005473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLSKHSAAMNGFGPDDVARGGGGPGEAPLPALVANAGEALPPPPPPPPPLPLPPPPPP
PPGLGMASSSVASSSPSASSGAIPAAASGPGAGQVCCLREEGERCGRAAGNASFSKRIQK
SISQKKVKIELDKSARHLYICDFHKNLIQSVRNRRKRKGSDDDGDSPVQDIDTPEVDLFQ
LQVNTLRRYKRHFKLQTRPGLNKAQLVEIIGCHFRTIPVNEKDTLTYFIYSVKNDKNKSD
LKLDSGVH
Download sequence
Identical sequences G1KE52
XP_016847979.1.98722 ENSACAP00000005356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]