SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005911 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005911
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000599
Family PDZ domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000005911
Domain Number - Region: 533-538,774-781
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005911   Gene: ENSACAG00000006061   Transcript: ENSACAT00000006043
Sequence length 1330
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343577.1:6460:48912:1 gene:ENSACAG00000006061 transcript:ENSACAT00000006043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEDGGKAALSQKMRSGDELVNINGTPLYGSRQEALILIKGSYRTLKMILRRRNVPVIRPH
SWHLAKLSEGRTEAPTMPCPPDAFSLSWHSGCDASDLSLPWSPLSRHCSTDRSSSLGSME
SLGPAGQSYLEGSLSPIDQAMYQDKRDSAYSSFSASSNASDSALRPEEGLSTESATQKQP
PPTDPRYLQTGVEGGDLAAGSRGGQPRLVTCAQTSAQAAPSAPQPPIRQDSLRACNPLPE
GPPNLKGRWTSDTSLCVRGQEIPGSTGHSKDSLATEQYYLLSSHTDQVMEKGVPNAESLL
NDGDEGDHPTEDRHLERKNDGARQDRCPDVSWPGPPGHRHSAPEHLLAAQLQMMNVSHVQ
EGPQWTVSPLHMEQKGPKAWQNQIQNRQRSPEQAEEPAPRLGTKGGTKSPLERPRSASVE
LPPSLSVQHQQLPGSGDPSVAPVGMNALTEGVRDAGRSHPAAKKGGSAPHRSAQMRRRSD
RFATNLRNEIQWRKAQLQKSKGSAALLFGEEAVEEAEEPPKSPSGLEPPSWSPPSPPPAA
PSPLPPPPPPSLAESRPHRSGPSIKRWSSELSVFGGDGAYRSPGPESRLRAPGPERPPKS
PLPPVPGRGGRWRWSPEHKLQPHNGSPQPPEPESPSRHSEESGLLPFADRRRFFEESSKP
LSPTYSRFGGVPPSRREEERSSAFQPVSCDHIGQQQQRRRHSMDHSYPSEPTYQEFYQPL
PRRRPDWECWQPLPFACAPREACPFCYGDQRCPPMHHRNPPAPPGHCAHRCHPLAWTRCP
DCCCPTPHQRLEERGGLWLGRKAFPMEFPADEWEPPAINRKTSQSMSYSLIILNKGTPEG
NCIPFLASSSCTLCCSLSSLEDFKQRLDVLSSLEDSKQRLGVFSSLEDFKERLDDSVFST
SHQSRPPSFFGPQGPPRSQAASATTATALRARAPSGPHRTPVTRSTSSRVRSLCPSVQYG
KRTHLSWQMASLMQNTELQRPSSSLEEEATPESAWENGQSGLIVHRTMEPASPGSLPRIP
LATHNQSQPLTDGHPAISDRWPPSLPQGAPSGAVRGRNRGPPLRHSQGSGAYHVSPGFAG
ADADRGQAPTERMKQIFQTFTLSKGTPSSPSCSAYYNTSVGKAEVPPKGAALSSEDEEEE
LDCDLAQKKVQLIESISRKLLVLQEAQRGLQDDLSANLALGKEVEGQVKGVCKAHEFEKF
RLFIGDLDKVVNLLLSLSGRLARVENTLSSLDPDTAEAEKLTLLEKKRQLSAQLEDAREL
QEHVAQRERLVFACVSRCLPSEQLQDYQHFVRMKSALAIQQRQLDDKIKLGEEQLRCLRE
SLRRTGPRDS
Download sequence
Identical sequences H9GAV8
ENSACAP00000005911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]