SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006533 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006533
Domain Number 1 Region: 31-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.26e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 3-13
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006533   Gene: ENSACAG00000006693   Transcript: ENSACAT00000006678
Sequence length 123
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343395.1:872168:899883:-1 gene:ENSACAG00000006693 transcript:ENSACAT00000006678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPPPPPPPPPPPERARDPPGASSEIKALQQTRRLLANARERTRVHTISAAFEALRKQVP
CYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLSFSECVEQCTRTLQAEGRSKK
RKV
Download sequence
Identical sequences H9GBS1
ENSACAP00000006533 ENSACAP00000006533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]