SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006540 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006540
Domain Number 1 Region: 273-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 234-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 132-141
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000837
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006540   Gene: ENSACAG00000006695   Transcript: ENSACAT00000006685
Sequence length 426
Comment pep:known_by_projection chromosome:AnoCar2.0:5:68319465:68337050:1 gene:ENSACAG00000006695 transcript:ENSACAT00000006685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSSSRPLPTGKSLLSGASSSSSSSKALAFSIERIMARTAPEPKARPLLPPFLPKAGEK
APPTGLGLGSSLPCMLPFVPLAYKPPGEPPPASKAELPPHFKLVRPRVVTHSSFHALGAL
GYFGRAAEIPPPPPPPPPPPPPPSSLNLHPVASYFLGSSLQSHKASLAERNKLQALPGPA
SAAPPGFKELAHAHFHSAAAAAAAAAHLLAAEKLPFKGAVAAEFSRASPGAKPKAFTCEV
CGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCSQCGKA
FNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQV
YNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSNGGTPSLALPRPPTAESEL
PPLPHS
Download sequence
Identical sequences G1KFL9
XP_003221377.1.98722 ENSACAP00000006540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]