SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006594 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006594
Domain Number 1 Region: 53-121
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000312
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000006594
Domain Number - Region: 22-151
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 177-217
Classification Level Classification E-value
Superfamily Nitrile hydratase alpha chain 0.0863
Family Nitrile hydratase alpha chain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006594   Gene: ENSACAG00000006707   Transcript: ENSACAT00000006740
Sequence length 263
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343670.1:150179:158943:-1 gene:ENSACAG00000006707 transcript:ENSACAT00000006740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAMFRSLLVSAGGSREAPPPPPPPPGGASASSSSAQAQAHHPPPPPEAAALEAQFSCP
ICLEVYQRPVRIASCRHSFCGECLQPCLQVTSPLCPLCRMPFDPKKVEKASSVEKQLSSF
KAPCRGCSKKVTLAKMRPHVTSCTKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFVCPY
CGARNLDQQELVKHCMENHRNDPNKVVCPVCSAMPWGDPSYKSANFLQHLLHRHKFSYDT
FVDYSIDEEAALQAALALSLSEN
Download sequence
Identical sequences H9GBV4
ENSACAP00000006594 XP_008120474.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]