SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006693 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000006693
Domain Number - Region: 102-283
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0212
Family At5g01750-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006693   Gene: ENSACAG00000006823   Transcript: ENSACAT00000006839
Sequence length 317
Comment pep:novel scaffold:AnoCar2.0:GL343435.1:245317:307359:-1 gene:ENSACAG00000006823 transcript:ENSACAT00000006839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQDSKSVPPPPAYSGPGYPAAQAQYGFPQYVPGSAIPGQPVANEGVTVQGQLTTPGPI
IWMPTPPPVPKCPPGLEYLCQIDQISIQQQIELMEMISGYETCNRYEVKNSMGQWIYFAA
EENNDFTLNMYGALRSFTIKLFDSRNQPVMQLSRAFHCAICCCPCVCCLQELEVQAPPGT
VIGYVKQKWHPCLPKFAIQNEARENVLKMAGPCVPCRCYSDIHFEVKALDEISTVGTISR
QWGGWAREAATDASSFQVQFPMDLDVKMKAIILGSCFLLDFMFFERSGNRNRQRRTTGMH
RAHRHHGVHARHGHHRR
Download sequence
Identical sequences H9GBZ4
ENSACAP00000006693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]