SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006775 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006775
Domain Number 1 Region: 118-260
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0000863
Family At5g01750-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006775   Gene: ENSACAG00000006915   Transcript: ENSACAT00000006923
Sequence length 268
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343435.1:393149:406960:-1 gene:ENSACAG00000006915 transcript:ENSACAT00000006923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRDQTQKDTLGPVYKTIQEPLPGSPDPPDLAKLSETAITWKPAQPPGTLPPGLESLKQ
LDQIIIHQQVELLQVILGTETCSKYEIKNCMGQRVYFAVEENGCFDRNFCSPLRSFTMRI
TDNTGQEVITVNRPLRCNSCWFPCYLQEVEVQSPPGTTVGYVVQKWDPLLPKFTIRNESN
EDVLKIIGPYGTCGCFGDVDFEVKSLTDMSTIGKISKYWSGFVNNIFTNTANFGIQVPVD
LDVKIKAVMIGACFLLDLMFFENSLDGL
Download sequence
Identical sequences H9GC29
ENSACAP00000006775 XP_003227040.1.98722 XP_008118267.1.98722 XP_008118270.1.98722 XP_008118271.1.98722 XP_016852662.1.98722 XP_016852663.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]