SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007007 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007007
Domain Number 1 Region: 90-248,511-617
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.06e-66
Family Protein kinases, catalytic subunit 0.00000148
Further Details:      
 
Domain Number 2 Region: 609-710
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000224
Family Protein kinases, catalytic subunit 0.0000947
Further Details:      
 
Domain Number 3 Region: 48-58
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000022
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000007007
Domain Number - Region: 29-62
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0785
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007007   Gene: ENSACAG00000007127   Transcript: ENSACAT00000007158
Sequence length 711
Comment pep:known_by_projection chromosome:AnoCar2.0:5:96487225:96615733:-1 gene:ENSACAG00000007127 transcript:ENSACAT00000007158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRKVLALQARRRRAKHPAAPGRKEKHPPHQPHKKPEPQQKVPSAPPPPPPPPPPPPLP
EPAPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLC
WDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMN
GIHVCMVFEVLGHHLLKWIIKSNYQGLPIRCVKSIIQQVLQGLDYLHSKCKIIHTDIKPE
NILMCVDDTYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKR
QAELLEKRLQEIEELEREAEKKKIEENVTSAVSSNEQEDEYHPEVKLKTVELEEVADEEP
GNEDGETEDQDEKEDTEKENTEKDDDVEQELVNSESADPTWIESPKTNGHIINGPFLLEE
QIEDDDEEEEECPNAEQYNLDEPNAKSSVFSGALDSVACGSAVSEESTVTEREGSPPSHD
RSRTVSASSTGDLPKTKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTR
QYRSIEVLIGAGYSTPADVWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGN
IPRHFALSGKYSREFFNRRDHIALIIELLGKIPRKYAMLGKYSKEFFTRKGELRHITKLK
PWSLFDVLVEKYGWPQEDAAEFTDFLIPMLEMVPEKRASAGECLRHPWLNS
Download sequence
Identical sequences G1KG81
ENSACAP00000007007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]