SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007108 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007108
Domain Number 1 Region: 165-240
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-24
Family Homeodomain 0.0000915
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000007108
Domain Number - Region: 331-375
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00502
Family Di-heme elbow motif 0.089
Further Details:      
 
Domain Number - Region: 82-93
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0994
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007108   Gene: ENSACAG00000007272   Transcript: ENSACAT00000007261
Sequence length 419
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343275.1:1240832:1256504:-1 gene:ENSACAG00000007272 transcript:ENSACAT00000007261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRKEISVMFLEGGALGPRAGKRASALAEAGGQETPQDKAMMHRRPRERRGGGEEEEEG
QGRSRRAARRAAALLLSAGQTPQPPPPPPPLHRLSAKGQQSSSDTESDFYEEIEVSCTPD
CGTGNVEYHQHGKGQGSEASTGSPSSSGGGEPPKSNGGGGGGGVGGGSSSQGSLSCSASD
QMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQ
RLAMTWPHPADPAFYSYMMSHAAATGNLPYPFPSHLPLPYYSPMGLGAASASAAAAAAAA
SPFGSPLRPLDTFRVLSHPYPRPELLCAFRHPSLYAGPTQGLGGGGGGGAAAGSPCSCLA
CHGGGGQSNGLPQRPPPASDFPCAAASTRTDSFLTFTPSVLSKSASVALDQREEVPLTR
Download sequence
Identical sequences H9GCH5
ENSACAP00000007108 ENSACAP00000007108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]