SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007131 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007131
Domain Number 1 Region: 227-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000219
Family Ubiquitin-related 0.015
Further Details:      
 
Domain Number 2 Region: 627-679
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000283
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 3 Region: 470-551
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000544
Family RING finger domain, C3HC4 0.0099
Further Details:      
 
Domain Number 4 Region: 544-611
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000671
Family IBR domain 0.016
Further Details:      
 
Domain Number 5 Region: 387-413
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000106
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000007131
Domain Number - Region: 87-124
Classification Level Classification E-value
Superfamily PH domain-like 0.0492
Family Pleckstrin-homology domain (PH domain) 0.067
Further Details:      
 
Domain Number - Region: 377-385
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007131   Gene: ENSACAG00000007245   Transcript: ENSACAT00000007286
Sequence length 703
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343789.1:110462:163801:-1 gene:ENSACAG00000007245 transcript:ENSACAT00000007286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAGLVLLASARAWVPRPASPSQKKPRHPQQQHPQQQQKRLLRLQLSAAPGPERFRLG
LKGAPDSGTETSLVEYSLKEISYEVKTPTCHELKVLARPDDPLVFHFEDEQEAQKWWSVV
STFLREAQKASEGPSLLPGRLLPHPSAAMNSLPTSEPEASLLSQLARKEELALRLSAAID
LGDEVEAVRSATALSQQQAPLRIVLKESCYPTSEISMKVQVEDAMYSASISTRVHTHTTI
AALRQQVFQDYGFHPSVQRWVIGQCLCVDDRTLSSYGIRRDGDTAFLYLLSAKGANLSEQ
RFKEDKDWVVLQPAPSPPADPSDARRKYSTLPNPQPKKGSKDGNRKMDIGEISQFLGSLQ
LGSLLPGHSRAPPAAAPAPPPPPPPVQAGWPCPTCTFINKPTRPGCEMCSTDRPANYVVP
GSYQPDETELWRIQQEKEGILQYQKAQEQERLLNFQQLRRLDAEALVPNREAMECRICYM
EADPGEGVLLRECLHSFCKDCLRQLINCTEEPQVSCPFRDDSYACGSHLQDREIRALVSW
EEYERFLERRLAVAESRAQNSYHCQTVDCLGWCIYEDDVNEFRCPICWALNCLVCKAIHE
GMNCKQYQDKLQFEAQNDAAARETSNMLKMLVQLGEAMHCPVCRIVVQKKGGCDWIRCPV
CQTEICWVTKGPRWGPGGPGDISGGCRCNVDGERCHPNCQNCH
Download sequence
Identical sequences H9GCI4
ENSACAP00000007131 XP_008121197.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]