SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007882 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007882
Domain Number 1 Region: 326-508
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.18e-55
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000000541
Further Details:      
 
Domain Number 2 Region: 897-1088
Classification Level Classification E-value
Superfamily Nucleotide cyclase 8.95e-54
Family Adenylyl and guanylyl cyclase catalytic domain 0.000000567
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000007882
Domain Number - Region: 37-117
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00549
Family Formin homology 2 domain (FH2 domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007882   Gene: ENSACAG00000007921   Transcript: ENSACAT00000008048
Sequence length 1165
Comment pep:known_by_projection chromosome:AnoCar2.0:6:53652888:53807636:1 gene:ENSACAG00000007921 transcript:ENSACAT00000008048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPDMEEIPFQKIKKSKKARKKCCRYCCCSSSSAGPPPPAPQQQHQAPLPPPPPAGSSG
GNATPASRRQLLLEGLACEDQFDCKELESLFQNYNLKLEQTSTLKALAVLIVLTASLALV
ELLSGPSLTISKGSHPVHCIIFLSLFIVTNVKYLQVTQLQQIVKLTLLFSFTFAFLCCPF
SLGAYGAEPPSSPEQGMWQLMLVTFVSYSLLPVRILLAGLFGLVVALCHLIVAAASVSAK
RQPLWRTLVANAILFVSVNLYGVFVRILTERAQRKAFLQARNCIEDRLKLEDENEKQERL
LMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVK
LLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVA
EATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKTTLE
CLNGDYEVEPGFGHERNSFLKKHNIETFFIVPSHRKKIFPGLILSDIKPAKRMKFKTVCY
LLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFTTNVVHNTPGTRVN
RYIGRLIEARQTESEMADLHFFTLKYKQIEREQKYHQLQDEYFTSAVVLSLILAALFGLV
YLLIIPQSTVVLVLLVFCICFLVACIMYLHVTRVQCFPGCLTIQIRTILCIFIVILIYSV
AQGCVVGCMPWVWNTNSSSSIVIISPSGTNKTMNELPCDAAHYAFLSCVMGTLTLAIFLR
ISSLPKMILLLFVTILYIAILELSGYRRAVGGGSFYIRGYEPILAILLFSCALALHSRQV
DLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYS
QVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKEYYRDIEKIKTIGST
YMAAVGLVPTTGTKAKKSIYTHLSTLADFSIEMFDVLDEINYQSYNDFVLRVGINVGPVV
AGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEEVQRILKCNYEFACRGKVSVKGK
GEMLTYFLEGKVNGNNSQLRSLNLERKMYPYGRSNIHTKLGTSCPSVSSSPSLSANAGAG
MLQLPSAHTNQTLHYLPSVPAIKEA
Download sequence
Identical sequences G1KHB4
XP_003222342.2.98722 ENSACAP00000007882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]