SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007897 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007897
Domain Number 1 Region: 503-581
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.98e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0000128
Further Details:      
 
Domain Number 2 Region: 295-333
Classification Level Classification E-value
Superfamily WW domain 0.00000734
Family WW domain 0.0054
Further Details:      
 
Domain Number 3 Region: 617-686
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000314
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000007897
Domain Number - Region: 26-39
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007897   Gene: ENSACAG00000008031   Transcript: ENSACAT00000008063
Sequence length 773
Comment pep:known scaffold:AnoCar2.0:GL343364.1:1058390:1077230:-1 gene:ENSACAG00000008031 transcript:ENSACAT00000008063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSENAPPLPKEPATEVNVETPSCPPPLPPNEQPPPPPLQTSSDAEVMDVGSGGDGQSD
NPAEDAHTAGGTQLLTKGSSCYKSRLLIESNSDQSPRTARHAPSVRKFTPDLKLLKDVKI
SVSFTESCKSKDRKVLYTGAEKDYEADSDLGVNNVNGGVHACPLSGGSDCQAACLAGENE
DKKEEDNEVDQEKRVEYAVLDDLEDFTDNLMEIDEEGGFTSKAIIQRDKVDEEILNYSYE
DEFDNDVDALLEEGLCVPKKRRIDEKYGAESDHQSDGETSVQPMMTKIKTVLKSRGRPPT
EPLPDGWIMTFHNSGIPVYLHRESRVVTWSRPYFLVTGSIRKHDPPLSSIPCLHYKKMKE
NEEREQSNDITPNGEVSPVKVLDKSLEVDCQAEEPDSTAADSGNLEERETSAGDAAQGAL
GQVKAKVEVCKDESVDLEDFRHYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESER
PILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSE
PFGASVIIDGVTYGAGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNH
ISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKH
TVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQ
YAKKNKPNLHILNKLQEEMRKLAQEREETRKKPKITIVESAQPGSEPLCTVDV
Download sequence
Identical sequences H9GDE6
28377.ENSACAP00000007897 ENSACAP00000007897 ENSACAP00000007897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]