SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007986 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007986
Domain Number 1 Region: 374-477
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-47
Family ets domain 0.0000579
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000007986
Domain Number - Region: 151-276
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 100-132
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.0402
Family Vertebrate phospholipase A2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007986   Gene: ENSACAG00000008128   Transcript: ENSACAT00000008157
Sequence length 518
Comment pep:known_by_projection chromosome:AnoCar2.0:3:34199906:34249601:1 gene:ENSACAG00000008128 transcript:ENSACAT00000008157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGFYDQQVPFMVPGKPCGDECRGRPMNDRKRKFQDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQPDNLVLHAPPPAKIKRELHSPSSELSNCSHEQVLCANYGEKCLYNY
CAYDRKPPAGFKPLTPPTTPVSPALQSGPLPPPPPLPAAPVQPPPPPPPHVATTAGPLQG
APPPPAPHALQEPRQQTFAVPRPPHQPMQMPKMMPENQYPTEHRFQRQMSEPCHPYPPPG
LSGDNRPVYHRQMSEPIVPAATHPPQGFKQEYHDPLYDHGVPGIPGPPTHGFQSPMGIKQ
EPRDYCIDSEVPNCQSTYVRGGGGYFPNSHDGFSYEKDARLYFDDTCVVPERMEGKVKQE
PPVYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQK
NRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAEPD
CHVNEDDTLPLTHFEDNSAYLLDLDPCSNLPYAEGFAY
Download sequence
Identical sequences G1KHF8
XP_003218420.1.98722 XP_016847617.1.98722 ENSACAP00000007986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]