SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008224 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000008224
Domain Number - Region: 412-422
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0201
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008224   Gene: ENSACAG00000008393   Transcript: ENSACAT00000008401
Sequence length 577
Comment pep:known_by_projection chromosome:AnoCar2.0:2:14645459:14693788:1 gene:ENSACAG00000008393 transcript:ENSACAT00000008401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSEEKNASPFLPKDSDQDSSVSSELQDEYEELLRYAVVTPKFEPSVLRQSVHTEVHQK
SAGKGPVMDGRRLETAGPSWRKHGRAPDFAPSTRTTRIEVSTAIKEPSRTDMEGLCPVDS
EESSSQESSCFQRDLQESNVTDLSLSDERVTQIESILDLWSGSLKTNVLTELRKWKLHFI
EHHTLEMRQEKEKHAAHVKQLMNQMENLKELLHTYEISIGRKDEIIANLTHAVEKQKDRI
ELMKKFAKWRLQHSIGRQEAKQEVYTNRLADRLYEMGLLKKAWMIWRSQIHTKWKETMER
ACQSSAESVRVELSNDYETKLQESNTALEQARAEIIDLQNKRQDYEDTMKKAFMRGVCAL
NLEAMTVFQGKEFKFDHVELSDKRGEPSAGNGGSTPKLPPSHFDPPLPPNTPPPPPRPPP
PPPTAAPGIALTEDLFSSHQSHAVTSQTRLDSGAALIAPSSAAASGIPSITKAPLTRVVT
AHQKAGRTITARITGRSDFASKNRIFSSLDVIGVSPPMNSVIVEKHHPVTQQTISQATAA
KYPRTVFSNGISPRPSGHSRKTHAQTHSNIHSIKVVE
Download sequence
Identical sequences G1KHQ8
XP_008101139.1.98722 ENSACAP00000008224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]