SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008247 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000008247
Domain Number 1 Region: 252-352
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.49e-28
Family Ras-binding domain, RBD 0.0000025
Further Details:      
 
Domain Number 2 Region: 44-145
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 1002-1099
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-22
Family PDZ domain 0.0000312
Further Details:      
 
Domain Number 4 Region: 411-507
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.46e-21
Family FHA domain 0.00000302
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000008247
Domain Number - Region: 1375-1500
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008247   Gene: ENSACAG00000008269   Transcript: ENSACAT00000008424
Sequence length 1832
Comment pep:known_by_projection chromosome:AnoCar2.0:1:224949666:225058970:-1 gene:ENSACAG00000008269 transcript:ENSACAT00000008424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGGGGGGSREEERRKLADIINHWNANRLDLFEISPPTEDLEFHGVMRFYFQDRAAGNF
ATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDIDEKPLVVQ
LNWNKDDREGRFVLKNENDALPPKKTQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRREK
EALRQALDNDGPFHGDDIENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQ
EFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVIEALEKYGLEKENPKDY
CIARVMLPPGAQHSDDKGAKESILDDDECPLQIFREWPSDKGILVFQLKRRPPDYVPKKL
KKQVDGKPLKGKERVDGSSYGSSLPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDK
PKLYRLQLSVTEVGTEKLDENSIQLFGPGIQPHHCDLTNMDGVVTVTPRNIDAETYVEGQ
RISETTMLQSGMKVQFGTSHVFKFVDPVQDHIPKGRLDAGHMVKSSRIKAGAVQETTFDL
EGDIHSGTGLSTSKSTNRLDSDRMSTSSTAERGMVKPMIRIEQQQDYRRQDGRPQDLHGP
ELILPASIEFRETSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSSQYRPDISPA
ERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQD
VLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSPQRPKIDDVLHTLTGAMSLLRRCR
VNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLEL
AADCHLSRIVQATTLLTMDKYLPEDIPNINSTCFKLNSLQLHALLQNYHCAPDEPFIPTE
LIENVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLD
PLCQRGFCRLTPHPRSPGTWTIYFEGADYENHLLQDNADLAQPLRKEPEIITVTLKKQNG
MGLSIVAAKGAGQDKLGIYVKSVVKGGAADADGRLAAGDQLLSVDGRSLVGLSQERAAEL
MTRTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKPRPKSEGFELYNNSAQ
NGSPESPQPWPEYNEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGTKNAYAAGTTNKIT
SVSTGNLCTEEQILPPRPEAYPIPTQTYTREYFTFPASKSQDRMGPAQNQWSSYEEKAQV
PEESNHYISAAMQRVTRSQEELRDDKVYHPERNRLEVVIRKDVEYIDRKSDSDPWMNSSV
DSSTSSQEHLNHSSKSIPPGSSLTKSGPGRWKTPIVPQPLSLAPAQSNRTDLPPPPPPPP
VHYAAEFDGLQMDLPLPPPPPPSSQLGPQASSQAAAAERKKREEHQRWYEKEKARLEEER
DRKRREQERKLGQMRAQPLIPTQPLLPPASVQQVKPEKPSTLQRSQETVIRELQPQQQPR
TIERRDLQYITISKEELSSSDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQNKPD
RTAEENDRLRKLMLEWQFQKRLQESKQKDEDEDDEEDDDIDTMLIMQRLEAERRARLQDE
ERRRQQQLEEMRKREAEDRARQEEERRRQEEERTKREAEQKRRQEEEYYNRLEAERRRQH
DEAERRLLEPDEPGLYRPPLPREYEFPSPPLSSNAPPPPPQRNTSYLKTQVLSPDTVYTA
KFVAYSDEEEEDPCNAKGINYTGSTGAIVGSHEPYQDPREKNSKSQDTELPGAPENLTFR
ERQRLFSQGQDVSNKVKASRKLMELENELNTK
Download sequence
Identical sequences G1KHR9
ENSACAP00000008247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]