SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008379 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000008379
Domain Number 1 Region: 362-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-34
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 183-293
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000449
Family Fibronectin type III 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000008379
Domain Number - Region: 34-141
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000222
Family Formin homology 2 domain (FH2 domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008379   Gene: ENSACAG00000008495   Transcript: ENSACAT00000008560
Sequence length 534
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343218.1:1191736:1231454:1 gene:ENSACAG00000008495 transcript:ENSACAT00000008560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCEARFSLAFSHSGGLTSSSRAVPLAMEAQKEALQRIISTLAHKNDEIQNFIETLNHTLK
GVQANSSSVIAELDEEFDGLYSILDEMKESMTTSIKQEHAHKTQELQNQLSQCSSSLENS
EELLEFAARSLDIKDTEEFSKAARQIKDRVTMAPAFRLSLKPKVSDNMTHLMVDFSQERQ
MLQALKFLPVPRAPEIVLSDCLVADNSVTISWQMTEEDNKIDHYVLEYRKTNFDGLPRIK
DERCWESIDYIKGTEYTLSGLRFDAKYMNFRVRACNKAVAGEYSDPVTLETKALLFNLDG
SSSHINLKVEDSYVEWDSTGGKSQENKIKGKENKGSGQITLLKNNTRSGTPSPKRSSVTS
RSPLIRGSRDRFTGESYTVLGDCSIENGQHYWEVKAQKDCKSYSVGVAYKNMGKFDQLGK
TNTSWCVHVNNWLQTTFAAKHNNKAKSLDVVVPDRIGVYCDFDGGQLSFYNATSKQLLYT
FKTKFTQPILPGFMVWCGGLTLTTGLQVPTAVKTLQKSENGLSGSASSLTNVAQ
Download sequence
Identical sequences H9GE10
XP_008113489.1.98722 ENSACAP00000008379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]