SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008860 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000008860
Domain Number 1 Region: 514-525,568-938
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.96e-102
Family Formin homology 2 domain (FH2 domain) 0.0000161
Further Details:      
 
Domain Number 2 Region: 34-158,221-454
Classification Level Classification E-value
Superfamily ARM repeat 4.03e-96
Family Diap1 N-terninal region-like 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000008860
Domain Number - Region: 501-548
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0863
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008860   Gene: ENSACAG00000008940   Transcript: ENSACAT00000009051
Sequence length 1017
Comment pep:known_by_projection chromosome:AnoCar2.0:2:94694702:94811311:1 gene:ENSACAG00000008940 transcript:ENSACAT00000009051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESGGDPGGGPGMLPPPLPPGKVPMPDQGELEERFAMVLSSMNLPPDKARLLRQYDN
EKKWDLICDQERFQVKNPPHTYIQKLKSFLDPGVTRKKFRRRVQESTKVLRELEISLRTN
HIGWVREFLNDENKGLDVLVDYLSFAQCAVMFDFEGLESGEDGPLEKLKSWSRSIEDLQH
PSTLSAPYANSLARSARQSALRYTTLPSRKALKNSRLVSQKDDVHVCILCLRAIMNYQYG
FNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFETFKKVCKEQ
HRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSR
HTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHLSHLTEKLLDLENENI
MRVAELEKQLLQREKELEIVKETYESASNQVHTLRRIIKEKEEAFRRHYSSHSAGGDHLP
LPPPPEVEINFSDIPEDDLRLPALPPMDAAPPPPPPPPPLPPPPPPLPDKCPPAPPLPGT
SPAMILTMGLSAIRIKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILEDLDLDRF
EELFKTKAQGPAIDLLCSKNKASHKAANKVTLLEANRAKNLAITLRKAGRTFEEICKAIH
TFDLKTLPVDFVECLMRFLPTENEVKLLRQYEKERKPLEELSDEDRFMLHFSKVERLTQR
MAIMAFLGNFSENIQMLMPQLSAIIAASASVKSSPKLKRMLEIILALGNYMNSSKRGSVY
GFKLQSLDLLLDTKSTDRKLTLLHFIAMMVKEKYPELSTFWQELHFVEKAAAVSLENVLL
DVKELGRGMELIRRECSLHEHSILRSFLSANEGKLDRLQKDARTAEEAYNTVVRYFGESP
KTTPPSVFFPVFARFIKSYKDAELENDLRKKQEQAQREQALAQEAKRLEKRNKWQQQELI
AELRRRQAKDHRPVYEGKDGTIEDIITVLKSVPFTARTAKRGSRFFCEPSHHDEPNC
Download sequence
Identical sequences G1KIE5
ENSACAP00000008860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]