SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008970 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000008970
Domain Number 1 Region: 554-796
Classification Level Classification E-value
Superfamily VPS9 domain 2.75e-45
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 24-146
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000401
Family SH2 domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000008970
Domain Number - Region: 246-268
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0207
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008970   Gene: ENSACAG00000009141   Transcript: ENSACAT00000009162
Sequence length 814
Comment pep:known_by_projection chromosome:AnoCar2.0:1:11297491:11353290:-1 gene:ENSACAG00000009141 transcript:ENSACAT00000009162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIAPRSCFPPPGIGVLEKLIKTCPAWLQLSLSKEKAAEILCKEPAGIFMVRKDEKMENLF
LSVHLTTQKETSEVLEYKIKEEKSFLYLEGSLLVFEDIFRLVAFYCVSRDLLPFTLRLPQ
AILEANSSTDLETISNLGTGFWDSALNQRQGRRFPHSVRGPAFATAQGKIVKNTNQCFAS
SANNCSCEIELSIGNDRLWFVNPIFIEERSHWFPLNVPPPESGRESSSFTRNTVQSPQKK
SPSRRPPPPPPPPPPPLHVLKQPDKPPMTTSEEDHLQDLGKNKKEMKTEAFKEKDGQQSF
FPDDSSSSAILKKCLPPSVPPRRCSTEKPSGKSCFDKSGPVPKPGGEQVAKQNALDMKLG
NKAKNPTELQKKPTENDSCAKDIQATEEKSTGPPIPPPRKKRLSRYPSSASSGYSKHTNT
EDLEVFSPDENPQTGEKTFSDIKRESKATFKLVSTSDCEGSRDSLHCPVGNTGLPTTTSE
LDSYSTSSTEDELESVSSPSVKKTRSMILGKARHRLSMVSLSNVFTAFLSADRKLQKKIV
ELAQDKDSYFGNLVQDYKVYSLEMMAKQSSSTEMLQEIRLMMTQLKSYLIQSMELKTFMD
QTVHTDEQLEVIIESALHKCVLKPLKEAIDSYLREIHSKDGSFKLLKENQQVIQNTTTTD
LGVTTSVPEAAVLEKILHKFTTMSKAYSPEKKISILLKSCKLIYDSMTQGNSGKPHGADD
FLPVLMYVLARSDLMEVLLNVEYMMELMDPALQLGEGSYYLITTYGAVELIKSYDKITVT
RQLSTEVQDSIHRWERRRTLNKARASRSSVQVRK
Download sequence
Identical sequences G1KIJ2
ENSACAP00000008970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]