SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009302 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000009302
Domain Number 1 Region: 300-352
Classification Level Classification E-value
Superfamily RING/U-box 8.95e-17
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000009302
Domain Number - Region: 7-16,46-62
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000811
Family Formin homology 2 domain (FH2 domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009302   Gene: ENSACAG00000009503   Transcript: ENSACAT00000009496
Sequence length 359
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343417.1:129011:133015:-1 gene:ENSACAG00000009503 transcript:ENSACAT00000009496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRARRPPPPPPPPPPRPWPCAAPGSPPRSSSPTEPRRRPPSGAAWSWDVPEWLPQTSWV
EKGWSERAPGQLIGWWRPSFPQVGDADPKVEEEDAWIGVVPVGEDQAEAPRCVAKEESFT
SAVVSKMKRALVLGASALLILALNQNALRELDVSQVLSKPVVLVQTSENVTKLFGALLRG
LRATAKITYQAVLLENVGVTLTLWSTCGLSRGGLYGEWQGVICTGENSSRVQKYLQQLWN
AILLIALILCTGLILQAQRQSRHGQREQDPEPDLKQHVARRLSALKTRRYHPPGKLPRSW
AHEIDCCAVCLDQFHKNQCLRVLPCLHEFHRDCVDPWLLLHQTCPLCKHNILGNCFQES
Download sequence
Identical sequences H9GF99
ENSACAP00000009302 ENSACAP00000009302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]