SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009341 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000009341
Domain Number 1 Region: 278-476
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.66e-49
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 493-567
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.2e-16
Family Blood coagulation inhibitor (disintegrin) 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000009341
Domain Number - Region: 23-120
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0654
Family Formin homology 2 domain (FH2 domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009341   Gene: ENSACAG00000009477   Transcript: ENSACAT00000009536
Sequence length 674
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343208.1:435056:496120:-1 gene:ENSACAG00000009477 transcript:ENSACAT00000009536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGRRSPLRQTSSSSSSPRLPPPPPLPRSLRWAWLLAFLLGCLGGVIADTALHWNETA
EERTLVDEDTAFQQTNSSSSKNNSHSTAFQKEITLPSRLVYYLNKDSESPYHILDTKTRH
QQKHNKAVHLAQASFQIEAFGSSFVLDLSLNNDLLSSDYMEIHYEDGKPQYSKGGEHCYY
HGIIRGIKDSKAALSTCNGLHGMFEDSSYVYLIEPMELIHSMTNTCRPHIIQRTLGRNIS
KHLEDPDDDSSSQQSFLSELPWLRRKKRAALRGVFEEMKYLELMIVNDHKMFKKHRSSHV
FTNNFAKSVVNLVDAIYKEQLNTRVVLVAVETWSDKDRFNIRPDPRQMLHDFSKYRQHFI
KQHADAVHLLSNVTFHYKRSSLSYFGGICSVARGVGVNEYGLPWAMAQELSQSLAQNLGI
QWEPGSRKQKGCDCTEPWGGCIMEETGVYHPRKFSKCSILEYRDFLYRGGGSCLFNKPTK
LFDTTECGNGYVEPGEDCDCGFKMDCYANCCKKCSLSNGAHCSDGLCCNDTCLFIPRGSE
CREAVNDCDITEICTGDSGQCPPNLHKQDGFACDSNQGRCYNGECKRRDSQCKYIWGPKA
SGSHKHCYEKLNTEGTSKGNCGKDGDRWIPCNKHDVFCGLLLCANLDGTPRIGHLEGEIT
PTSFFHQGVVVNCR
Download sequence
Identical sequences H9GFB4
ENSACAP00000009341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]