SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009374 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000009374
Domain Number - Region: 34-45
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0256
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009374   Gene: ENSACAG00000009504   Transcript: ENSACAT00000009569
Sequence length 773
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343198.1:1446010:1479682:1 gene:ENSACAG00000009504 transcript:ENSACAT00000009569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPQKHGGGGGGGAGPALALRAREEEGAPPRPPPQPPPPQPPPPPREGASGARLPLRRPA
ANLGAPLEGRAAAAFILPLAAAGAAPRPPRRHRLLRGPPAGEEAQDGADPGDHELFLQSF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFRVDGMLTKVEKTKGEHDL
QSLSAHLQLTFTGFFHKNDKPLQNSENEQSSVNLEVLLVKVCHKKRKDVSCPIRQVPTGK
KQVPLNPDLNQIKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNSSNREDGEKIFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPV
SKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNEKPAAPTARPLSTRNSESLPQ
ENKPSSVKPTQTIAVKETLPSDLQTRKERDVSNEPRQKLRIFYQFLYNNNTRQQTEARDD
LHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIH
RQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFH
SDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFI
ADNQMNHACMLFVENYGHKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQK
LEKGESPATTVTEELSEEQTGTANGCNEANTRERSSEMDSISCLTKQNRKQKI
Download sequence
Identical sequences H9GFC2
ENSACAP00000009374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]