SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010150 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010150
Domain Number 1 Region: 145-220
Classification Level Classification E-value
Superfamily Homeodomain-like 2.44e-24
Family Homeodomain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000010150
Domain Number - Region: 87-96
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0118
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010150   Gene: ENSACAG00000010339   Transcript: ENSACAT00000010360
Sequence length 258
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343206.1:1109603:1135606:-1 gene:ENSACAG00000010339 transcript:ENSACAT00000010360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQPTPKRCFTIESLVAKDSPTALPASRGPAEEPLRPAALSYTNAAGPVNPFLNGFHAAA
AAAAAARGVYAANPDLVFAEANAPVHPPPPPPHPPPHALGAHPLPGAHAPHPLFAASQQR
DPAAFYPWLIHRYRYLGHRFQGNETSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFE
KNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRW
RIATKQASPEEIDVTSDD
Download sequence
Identical sequences H9GGB0
ENSACAP00000010150 XP_008113019.1.98722 ENSACAP00000010150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]