SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010456 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010456
Domain Number 1 Region: 111-141,193-235,341-586
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.45e-85
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000010456
Domain Number - Region: 33-43
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00123
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010456   Gene: ENSACAG00000010604   Transcript: ENSACAT00000010672
Sequence length 591
Comment pep:novel scaffold:AnoCar2.0:GL343417.1:748458:758648:1 gene:ENSACAG00000010604 transcript:ENSACAT00000010672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFDGRRRPGAQPGPALGGEPRVGPRERSGLRPPPPPLPPPPPVDFEDAREAFRSKSSAE
LARGLLVLGLCSFGPLVENASQLMQLSQRLLGRDLFEKLMKMTFYGQFVAGEDQEAIRPL
IRHNRAFGVGSVLDYSVEEDLTPKEAEEKELDSCTSAFEKETGKQREKRYSVHRKFGDRR
DGVISARTYFYADEGKCDRHMDTFLKCVEASGGSSDDGFSAIKLTALGRPQFLLQFSEVL
VKWRRFFHQLAAEQGKVGLAALETKLEVEKLQEALAKLGIATRAESQHWFTGEKLGGSGT
VDLLDWNSLIDTRTEISKLLLIPNIKTGQLEPLLSHFTEEEEKQMKRMLQRMDVLAKQAV
KMGVRLMVDAEQTYFQPAISRLTLEMQRKFNQEKPSIFNTYQCYLKDAYDNVTVDVELSR
REGWHFGAKLVRGAYMEQERRRAADVGYEDPINATYEETSKMYHRCLDYILEEIRHNRKA
NVMVASHNKDTVKFTLRRMADLGIHPSENKIYFGQLLGMCDQITFPLGQAGFPVYKYVPY
GPVHEVLPYLSRRAQENQGFMARAQEERALLWVELKRRLFSGSLLSAPSPP
Download sequence
Identical sequences H9GGM4
ENSACAP00000010456 XP_003226862.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]