SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010580 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010580
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.88e-67
Family D-ribulose-5-phosphate 3-epimerase 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010580   Gene: ENSACAG00000010750   Transcript: ENSACAT00000010798
Sequence length 228
Comment pep:novel chromosome:AnoCar2.0:1:113346107:113354783:1 gene:ENSACAG00000010750 transcript:ENSACAT00000010798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCRIGPSILNSDLAALGAECTRMLDCGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQQPFFDMHMMVAKPEQWVKSMAVAGANQYTFHIEATDNAGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTIHKCAEAGANMIVSGSAIMKSDDPRSVINLLRNVCCEAAQKRSLDR
Download sequence
Identical sequences G1KKI6
ENSACAP00000010580 ENSACAP00000010580 XP_003215177.1.98722 28377.ENSACAP00000010580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]