SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010731 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010731
Domain Number 1 Region: 166-235
Classification Level Classification E-value
Superfamily Homeodomain-like 3.04e-26
Family Homeodomain 0.00012
Further Details:      
 
Domain Number 2 Region: 63-72
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000146
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010731   Gene: ENSACAG00000010955   Transcript: ENSACAT00000010953
Sequence length 283
Comment pep:known_by_projection chromosome:AnoCar2.0:2:71987091:71988948:-1 gene:ENSACAG00000010955 transcript:ENSACAT00000010953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMSSYLMDSNYIDPKFPPCEEYSQNNYIPDHSPEYYSRTREPSFQHHHQELYPPPPPPP
PPPPPPPPPPPPPRPSYPERQYSCASLQGPGNPSVHPRGHGPPPGGHHLPEKPPQPQLCD
QTALPSAATSPSPAPPACNQQNPDHPSSTASKQPIVYPWMKKIHVSTVNPNYTGGEPKRS
RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPN
TKVRSTAPANSSTGSLPAAPSNASEDHSQSSSQEARAEDITRL
Download sequence
Identical sequences G1KKN8
28377.ENSACAP00000010731 ENSACAP00000010731 ENSACAP00000010731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]