SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011046 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011046
Domain Number 1 Region: 658-792
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00000196
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.013
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000011046
Domain Number - Region: 398-403
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0131
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011046   Gene: ENSACAG00000011122   Transcript: ENSACAT00000011274
Sequence length 813
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343410.1:290054:397711:-1 gene:ENSACAG00000011122 transcript:ENSACAT00000011274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTGLKKRTRKAFGIRKKEKDNDSTGSPDRDGTPPSPHPHDPPSNSKPECAQEGGKTVSK
RSNGAPNGFYSEIDWERYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEEAHKKFN
IKIKPLQSKDALKSAATVDELKASIGNIALSPSPVRKSPRRSPGTIKRNLSSEEIARPRR
STPTPELLSKKTTEDPAVLAPLFGPPLESAFEEEKLEAPIDQPEVWGSVQPESVESPNSS
QPFPSGTPPPLPPKNIPATPPRTGSPLTTGVGNDQTATEVKSDKLPSINDLDSIFGPVLS
PKSVAADAEDKWISFSDQSLENVTPEVTSREKVVSPPVVSEIPDEPPEAETSRSVPSPLN
LEEVQKKVSEQTHVKDDNLAAAAASPKDFGVGQRATPPPPPPPTYRTVVSSPGPSSGGGT
GSTSGSSSPARPATPLASCSSPTPPPPPPRPPSRPKLPPGKPGVDVSRPFSPPIHSSSPP
PIAPLARAESTSSISSTNSLSAATTPTIENEQPSLVWFDRGKFYLTFEGSSRGPSPLTMG
AQDTLPVAAAFTETVNAYFKGADPNKCIVKVTGEMVLSFPAGITRHFANNPSPAVLTFRV
TNYNRLEHVLPNPQLLCCDSTQADANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLK
YQVSAQGIQSTPLNLAVNWRCEPTSTDLRIDYKYNLEAMTTPVALNNVQFLVPIDGGVTK
LQAVLPPAIWNAEQQRILWRIPDISQKSENGGVGSLLARFQLSEGPSKPAPLVVQFTSEG
STLSSCDIELVGAGYRFSLIKKRFAAGKYLADN
Download sequence
Identical sequences H9GHD4
ENSACAP00000011046 ENSACAP00000011046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]