SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011097 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011097
Domain Number 1 Region: 358-480
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.32e-33
Family DEP domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 183-295
Classification Level Classification E-value
Superfamily PDZ domain-like 1.17e-23
Family PDZ domain 0.000027
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000011097
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00155
Family DIX domain 0.02
Further Details:      
 
Domain Number - Region: 35-61
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0392
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011097   Gene: ENSACAG00000011181   Transcript: ENSACAT00000011326
Sequence length 529
Comment pep:novel contig::AAWZ02037606:263:12658:-1 gene:ENSACAG00000011181 transcript:ENSACAT00000011326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKEEISDDNAKLPCFNGRVVSWLVSSETPQPEPPPPPPPVEVRPEPSPPPPPLPPLPVE
RTSGIGDSRPPSFHPNVSGSHENLDHETETESVVSLRRERPRRRESMEHGVPGGHRLNGQ
SRLERHLAGYESSSTLLTSELETTSLCDSDDDDTMSSRFSSSTEQSSASRLLKRHRRRRK
QRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMK
GGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLREIVHKPGPIVLTVAKCWDPSPQG
YFTLPRNEPIQPIDPAAWVSHSAALTGAFAAYPGSSSMSTITSGTSVTETERFDDFNLSI
HTDMASVTKAMASPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFQDRREARKYA
SNLLKAGFIRHTVNKITFSEQCYYIFGDFSGCENYMANLSLNDNDGSSGASDQDTLAPLP
LPGATPWPLMPTFSYQYPAPHPYSTQPPYHELSSYSYGMGSAGSQHSEG
Download sequence
Identical sequences H9GHG2
ENSACAP00000011097 ENSACAP00000011097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]