SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011558 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011558
Domain Number 1 Region: 120-194
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.53e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 6-16
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000262
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011558   Gene: ENSACAG00000011825   Transcript: ENSACAT00000011798
Sequence length 214
Comment pep:known chromosome:AnoCar2.0:6:28648520:28649164:-1 gene:ENSACAG00000011825 transcript:ENSACAT00000011798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQQQPPPPPPPPPPPSQDESRSPASPADDSLSNSEEEPDRQQQQQLPGKRGARKRRSSR
RSLAGNGAGEGAVSAQEPCSPAQGKRGKKCGSGSGSGGGGGGGGSSSGGGSPQSYEELQT
QRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEL
DSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
Download sequence
Identical sequences A7Z092
NP_001280041.1.98722 XP_003222065.1.98722 ENSACAP00000011558 ENSACAP00000011558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]