SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011593 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011593
Domain Number 1 Region: 325-449
Classification Level Classification E-value
Superfamily PX domain 0.0000000000061
Family PX domain 0.0091
Further Details:      
 
Domain Number 2 Region: 1077-1103
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000124
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000011593
Domain Number - Region: 135-394
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011593   Gene: ENSACAG00000011813   Transcript: ENSACAT00000011833
Sequence length 1133
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343265.1:408099:435308:-1 gene:ENSACAG00000011813 transcript:ENSACAT00000011833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKMKLPGNAKEEGEGEEAAAAAGGGGGRRRGLLNCLCGCPGGEGREAVYEWFGLSLGLA
QRLEFAVGLLDLLNPLELRFLGSCLEELARKDYHCLRDSEAKANGAAAEAGSAGTGLPQP
PQPPPPSSPPAASSPPPPPIPPLPPPPGGSDFRDPATRSRLIVYLALLGSENREAAGRLH
RLLPPVDAILRSCRRPPLGPLPGQEEAEEEEEGAGARPGPAEEGLGLGPAAREELLLLFT
MASLHPAFSFHQRVTLREHLERLRRALCRDDGDGRDDGYACHAGSSPNVPHNCMPSNESS
LLEQRVALHDKSMVTSHRPQQEAVHIQKIMLKGGPRKRSDKHLEYTFKVIWSDHSTSCVT
KTHQELQEFLLKLPRDLSSEAFDKTILGALHQGLQKQEERRYPDLEPMIRQLFSTTSQAF
LQNQKVNNFFQSLSSESLHAQNNFQSSLKTSKIPEHFKEDSSEASSQEEEIIQHTAIHKK
HNGKCPVANTVNTKCSSLDGFGITHSEHNGVPDWRRKGCALQQHPEHCTMLDQNTGDKRN
LPVMNKKKGKLQPEKDKGKRNDNRLAIRSNCVRVADTYDLHPGITKDSNLDVTVGHDTCG
ETSSESYSSPSSPRHDGRESFESEEEKDRDTDSNSEDSGNPNMMRFTGYGSADLTKSSAQ
LSVRSDNPNIVEDALNPQFQHISFMPSLHCVVLNGAQKPETVVPPPIPTDGKALGMVVTN
STPVGMGLVGESEKPIELLPSPLPANFLPPAIQPGSPALHVAVHRMKMPPPQASSESCAV
SGAPPQQTGNLSIGSPTTAFIPVHNPGNFPGSTVPTTDPVSKPASHVLGLNQMVPHVEGS
AGVISQSSSLKVVVSAAGLSTALPPAPFPVPVTLHATSVLPNQSSTVLNTVASTPPPPPS
SGLCVSQVQPTVPPAIPTHTPGPAPSPSPALTHSTAQSDSTSYISAAGNTNANGTLLSPQ
QLGSGPCGSCGRRCSCGTNGSLPINSYFYHNPLPGQVYRVPPFFTLPSLCNGSYLNQAHQ
TNGTQIPFYLHRSPYPNGLMHDPVMGSQTNYGMQQMAGYGRFYPMYPAQNVVANTNASCP
KKNGNVSCYNCGVSGHYAQDCKQSSMEASQQGTYRLRYAPPPPPSNDTLDSAD
Download sequence
Identical sequences H9GI57
XP_008115069.1.98722 ENSACAP00000011593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]