SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011889 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011889
Domain Number 1 Region: 122-293,363-510
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-38
Family WD40-repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000011889
Domain Number - Region: 30-164
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011889   Gene: ENSACAG00000012138   Transcript: ENSACAT00000012133
Sequence length 514
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343201.1:3775683:3790930:-1 gene:ENSACAG00000012138 transcript:ENSACAT00000012133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWRARRFAQGRGRAPLGQGSGGPSLSLPPPSPPPSPRPPSPPPPAAAPDSLPTSTAPAS
CSSGPSSSSSWTGGEGLFSWVRGRQLGRGGRCVEPARETFGAMTGLYGAIQPADSVSPIT
RTHGAVFNLEYSPGGSVLTVACEQTEVLLFDPISSKHIKTLSTAHEDCVNNIRFLDNRLF
ATCSDDTTIALWDLRKLDSKVCTLHGHTSWVKNIEYDTNTRLLVTSGFDGNVIIWDTNRC
TEDGCPHKKFFHTRFLMRMRLTPDCSKMLISTSSGYLLILHDLDLTKSLEVVSYPILRAR
RTTSNSDLASATSSGPRSSGSPGHQGDSSPMSEKHTVRATQREGGSPRNSLEVLTPEVPG
ERDRGNCITSLQLHPKGWAALLRCSSNTDDQEWTCVYEFQEGAPVRPISPRCSLRLTHCI
EEANVGRGYIKELCFSPDGRMIASPHGYGIRLLGFDTQCSELVDCLPKEAAPLQEIRSLY
SHGDVVLTTKFSPTHCQIASGCLSGRVSLYQPKF
Download sequence
Identical sequences H9GIJ8
ENSACAP00000011889 XP_003223376.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]