SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012009 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012009
Domain Number 1 Region: 101-461
Classification Level Classification E-value
Superfamily ARM repeat 2.42e-105
Family Diap1 N-terninal region-like 0.000000000049
Further Details:      
 
Domain Number 2 Region: 716-728,762-1070
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.75e-88
Family Formin homology 2 domain (FH2 domain) 0.00000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012009   Gene: ENSACAG00000011971   Transcript: ENSACAT00000012254
Sequence length 1082
Comment pep:known_by_projection chromosome:AnoCar2.0:4:76361639:76462050:1 gene:ENSACAG00000011971 transcript:ENSACAT00000012254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSGRGGGPSARGAGREKKKGKSPEEPTVAAVSAGDPGGGGGGKSRKFNLKRVMADELE
RFTSMRIKKEKEKSNAAHRNSSASYSDVSGQLLQEISDEDVLVLFEQMLVDMNLNEEKQQ
PLREKDIVIKREMVSQYLHTSKAGMSQKESSKSPMMNIQELKSGLRDAQLLNCLESLRVS
LNNNPVSWVQNFGAEGLNCLLDILKGLHDEKDDILGPYDTRIKHEIIRCLKAFMNNKFGI
KTMLETEDGILLLARSVDPKVPAMMIDAIKLLSALCILPQPVDMHEQVLGALTERAEMDE
VERFKPILDGLKSGTSVALKVVCLQLINALIIPADELDFRVHIRSELMRSGLQQILKELR
TLDNEELLVQLQVFEESGEEDSADLRSRLEDVRIEIDDPSEVFQILLNTVKDSKAEQHFL
SMLQHLLLVRNDYEARPQYFKLIDECISQIVLHKNGADPDFRRKHLDLHIEGLIDNLIDQ
TKVAKSEAKAIELEKKLDSELTARHELQVEMKKKENDLEQKLQDLLHEKETLESEKEQVS
LEKKSLENTTSLLNDQIASLMQELEDLKKKMEHITSSSVSPGGAEVSPTPPPPPPPPPLP
GGAAVPPPPPPPPPPPLPGAVAVPPPPPLPGAAAVPPPPPLPGAAGIPPPPPPPPPLPGM
AGVPPPPPPLPGMPGIPPPPPPLPGMTGGPPPPPPLPGMAGMPPPPPPLPGMAGVPPPPP
PLGVPPPPMPPAFGSMTTAAPALPFGLTPKKLYKPEVQLRRTNWSKITAQELSEDCFWAK
AKEDRFENDELFAKLTLAFSSAQAKSIVKKQQENEEEKGQAKKKVKELRVLDSKNAQNLS
IFLGSFRMPYEEIKNAILEVNEVVLTESMVQNLIKLMPEPDKLKMIAELKGDYAELPEPE
QFGVVISSVSRLMPRLRAILFKLQFSEQVENIKPQIVSVTAACEEVRKSENFSNLLSIIL
LVGNYMNSGSMNAGAFGFNISFLCKLRDTKSADQKLTLLHFLVETCEQQYPDVLKFPDEL
IHVEKACQVSAENLRKNLDQMKKQISDVQRDVDSFPSATEEKDKFVEKMTISFKIQFIGK
SK
Download sequence
Identical sequences G1KM11
ENSACAP00000012009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]