SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012170 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012170
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-22
Family Ubiquitin-related 0.0000583
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012170
Domain Number - Region: 710-715,854-926
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000445
Family Formin homology 2 domain (FH2 domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012170   Gene: ENSACAG00000012381   Transcript: ENSACAT00000012418
Sequence length 1193
Comment pep:known_by_projection chromosome:AnoCar2.0:2:193981559:194017022:-1 gene:ENSACAG00000012381 transcript:ENSACAT00000012418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPENLEVMVKTLDSQTRTFTVEEEITVKEFKEHIASSVNIPAEKQRLIYQGRVLQDDK
KLKEYNVGGKVIHLVERAPPQTQSPSSGGPSGVGSSSVPHNGAGPRGTGPTVHDRNANSY
VMVGTFNLPVSIMDPQPPTQSDGSSVDVHINMDQAPIQSEPRIRLVMAQHMLRDVQGILN
RLEGRTNGQAPSGSEEMPSASPTEREPMEGAESEPSSEPTAAEETPPSGTEPPPAPDAAT
PNHPSPSEYVEVLGELRGVENRLQPFLQRYEEILGTAGSADYNNNTEGREEDQRIINLVG
ESLRLLGNTFVTLSDLRCNLSCNAPRHLHVVRPMSHYTAPMVLQQAAIPIQINVGTTVTM
TGNGSRGAQTSSEGSTASQTSPPAQPGTSTPPDAGRPTEGSPPAASSPGAAPTQTQGSQT
GHPRVIRISHQTVEPVVMMHMNIQDSSSPMGGSGTGGAPPAGTPGPIGHTPGMGGAPHMP
LPSLPPEFMQAVAHQITQQAMAAAASAAAGQQVPSFQSAPTRVMIARPSAPSVRPTHPGS
PQAPGQGPPSLGGNASLAQMISGLVGQLLMQPVIVAQGSGTTASAPSSVNTQATFSTSNS
ASPPTASASAGTTNTATTAAGGSSAGAPGGPIPSSQPPTAGAELQLSQLSQLLGNFFGAT
GSTMAGMAGVGSPTITVAMPGVPAFLQGMTDFLQATQMGAAPPHPPEQSPPPPPPQPEAT
PPPPPPPSAPQSGTEAPSGSVGGSGVRGGASSADAPPPEFFTSVVQGVLSSMMGSLSAQQ
CSTESIADFIQRLSGTSNIFEPGTEGALGFFGDLLSLICQNFSMVDMVMLLHGQFQPLKR
IQPQLNRFFREEYLHGQEPTDRNIQMATYNLINGLEDYIRESFASVRVRDGVDITRTNLE
FLQEQFNRIATHILRCTDNTFGYRLLELCNQGLFECLALNLYCLRGEQGALTAVINDRIR
RMSADMNPSLVSWLTTMMSMRLQVILEHMPVTEEQVLQYVRRVGDPPQPAPEEPMDLQTV
EQAPETLQRDSVASPAPATTAEEAMPQQRGEPEHEEPQQAEPPAPEAEPWAAAVPPEWVP
IIREDIQTQRKLKQQPPLSDAYLSGMPAKRRKTMQGDGPQLLLSEAVNKAAKAAGVKPLT
STESLSRDLAEPALQEGYRQQLKSDLQKRLQADPSFTPQRFPNAQQVFVAEDP
Download sequence
Identical sequences G1KM96
XP_008103892.1.98722 XP_016847297.1.98722 ENSACAP00000012170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]