SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012208 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012208
Domain Number 1 Region: 85-371
Classification Level Classification E-value
Superfamily Kelch motif 3.07e-44
Family Kelch motif 0.026
Further Details:      
 
Domain Number 2 Region: 1907-2089
Classification Level Classification E-value
Superfamily Fibronectin type III 3.2e-19
Family Fibronectin type III 0.0000299
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012208
Domain Number - Region: 371-415
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00324
Family Fibronectin type III 0.0076
Further Details:      
 
Domain Number - Region: 1639-1648
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012208   Gene: ENSACAG00000012364   Transcript: ENSACAT00000012458
Sequence length 2124
Comment pep:known_by_projection chromosome:AnoCar2.0:2:88372946:88399784:-1 gene:ENSACAG00000012364 transcript:ENSACAT00000012458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASPIVPRGGSPTGAGSGLGLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGG
NEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLY
ELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLN
DLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGD
LWTLDIDSLTWNKPTLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWK
CTNTLACLNLDSMAWEPILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQV
CCKDLWYLETEKPPSPSRVQLVRANTNSLEVSWGSVPTADTYLLQLQKYDIPAATSPAAN
PVPSVPVNPPKSPAPAAAAPVAAVQPLAQMGITLLPQTTAVAAAAAGATAAAPAPPTTTT
IQVLPTVPSSPMPVPAPVAAIATPRPQVAVPAMLKVTGPQATTGTPLVTVRSAGQPGKGP
VTVTSLPAGVRMVVPTQNTQGTVIGSSPQMSGMAALAAAAAATQKIPPSSTPTVLSMPAG
TTIVKTVAVSPGTTSLPTTVKMASSPVMVSNPATRMLKTAAAQVGTSVSPSTTNTPNRPI
ITVHKSGTVTVAQQAQVMTTVVGGVTKTITLVKSPISVPGGSALISNLGKVMSVVQTKPV
QTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITSSQAGGTGTKPTILG
ISSVSPNTTKPGTTTIIKTIPMSAIITQSGATGVTSSPGIKSPITIITTKVMTSGTGTPA
KIITAVPKLTTGHGQQGLTQVVLKGAPGQPGTILRTVPMSGMRLVTPVTVSAVKPTVTTL
VVKGTTGVTTLGTVTGTVSTSLAGTGGHNTNASLATPITTLGTIATLSSQVINPAAITVS
AAQTTLTAAGGLSTPTITMQPVSQPTQVTLITTPSGVEAQPVHDLPVSILASPTTEQPTA
TVTIAESGQGDPQPGTVTLVCSNPPCETHDTGTTNTATTTVVGTLGGQTQLQFVCDGQDG
NGLQANGRVVRVCSNPPCETHETGTTNTATTVLSAVQKVCSNPPCETHETGTTNTATTSK
TEKAPTDPPCQTFQTSATGTTMTVKPIVGTSQRTEPTNPPCQTKQTTTTSTTMSTKADVA
TEQPCSVRMVSFGTAAGTPSVASATSAAQPSERLPAPKNLKCESHHTHTTNTATTARSLM
GRGQPDALKVSAKNASPQVCSNPPCETHETGTTNTSTVASSNMGAAQRVCSNPPCETHET
GTTNTATTATSSMAAGQQVCSNPPCETHETGTTNTATNTTSNMGAGQNEGAGHGQSTQQT
LVTQPCETQQTSSTSTTMTTSIEGDSTQVSSSVLAQCGASESGKGSEGEAPGPDGLPPHS
PSPRVCSNPPCETHETGTTHTATTVTSSMGTNQDQPPATNGQQGEPETSASESTAASSPS
TAATAATTVPSTHTRAVTTVTQSMPPPGPSVPNISSLSDAPAEEAAPPVETPAVTSTDDL
PRPPESLRPSVGVQEPAAVAPEPQEQVQAASASPPPAEVPPIEATPQPDLPVPMEETPPA
PSVQEPVAMVVLPQAASAPPPPPPPPPPSEVEQLALPQELMAESQAGTTTLMVTGLTPEE
LAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVMVQTPASFPGSGEAMDTSETATAQA
EVRHLASGASENQTPAIPIVLTQQLAALVQQQHQLQEAQAAAAAAAAAAQQHQPQHPLPS
HLPTEALAPADSLNDPASESNGLNELASAVTSTVGLLPPTPTESLAPSNTFVAPQPVVVA
SPAKLQAAAALAEVANGIEPAPVKPEPPAQPPKVVVKKENQWFDVGIVKTTNMMVTHYFL
PADDALLTDDDSGTIPDYSQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGF
PGAPCAIKISKNPDGAHLTWEPPSVTSGKITEYSVYLAIQSAQAGEPKSAAPAQLAFMRV
YCGPSPSCLVQSASLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQESNKDGSMVK
PANKRPLSSPDLKTAPKKPKADGQ
Download sequence
Identical sequences G1KMB6
ENSACAP00000012208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]