SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012353 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012353
Domain Number 1 Region: 55-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000615
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 145-187
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000235
Family Hairy Orange domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012353
Domain Number - Region: 9-18,131-141
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00131
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012353   Gene: ENSACAG00000012577   Transcript: ENSACAT00000012606
Sequence length 420
Comment pep:known chromosome:AnoCar2.0:2:173033011:173042638:-1 gene:ENSACAG00000012577 transcript:ENSACAT00000012606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPPPPPAPPCLGKLATLEGSEMPGLDFAHMYQVYKPRRGLKRGDDSKETYK
LPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNRIEQQ
QQQILALQKGLHADELPPRSLDSSQEVFRSGFQMCAKEVLQYVAKHENAKELKSSQLISH
LHRVASEVLQVGIGRKPGDTAPRPTDLKEKSGSLTKTTEAHGKNCVPVIQRTFAHSSGEQ
SGSDTDTDSGYGGELEKNDSKSDAQYFKKDSDLKYGVQERIGSIKQESEDPPAKRTRIEM
SEDEDHFSSDMLGSPSSSFLGPHAHQPPLCLPFYLIPPSATAYLPMLEKCWYPASVPILY
PSLPTSTAALSGLMSPEKMSSPLLMPQRLPSPVPSHSPMDSTALLQALKQMAPLNLETKD
Download sequence
Identical sequences G1KMI4
28377.ENSACAP00000012353 XP_003217834.1.98722 ENSACAP00000012353 ENSACAP00000012353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]