SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012509 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012509
Domain Number 1 Region: 208-247
Classification Level Classification E-value
Superfamily WW domain 0.00000000000011
Family WW domain 0.00066
Further Details:      
 
Domain Number 2 Region: 151-190
Classification Level Classification E-value
Superfamily WW domain 0.00000000000012
Family WW domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012509
Domain Number - Region: 29-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012509   Gene: ENSACAG00000012742   Transcript: ENSACAT00000012765
Sequence length 486
Comment pep:known_by_projection chromosome:AnoCar2.0:3:192366647:192475998:-1 gene:ENSACAG00000012742 transcript:ENSACAT00000012765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASTTGQTPPQASAPESGGSGQPQQQAPPPPPPPPAGHQIVHVRGDSETDLEALFNAVM
NPKGANVPHTLPMRLRKLPDSFFKPPEPKAHSRQASTDAGTAGALTPQHIRAHSSPASLQ
LGTVSPGALTPSSVVPGGAPSQHLRQSSFEIPDDVPLPPGWEMAKTPSGQRYFLNHIDQT
TTWQDPRKALLSQMNATAPTSPPVQQNIMNSATGPLPDGWEQAMTQDGEIYYINHKNKTT
SWLDPRLDPRFAMSQRISQSTPVKPPPLAPQSPPGGVLGGGNSSQQQQMRLQQLQMEKER
LRLKHQELLRQALRNINPSTANSPKRQELALRSQLPSMDQDGSQNPVSSPGMSQELRTMT
TNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVEEMDTGDTINQSNIPSHQ
NRFPDYLEAIPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKE
SFLTWL
Download sequence
Identical sequences G1KMR2
ENSACAP00000012509 XP_003219348.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]