SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012544 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012544
Domain Number 1 Region: 244-504
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 4.97e-115
Family Transcriptional factor tubby, C-terminal domain 0.000000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012544   Gene: ENSACAG00000012730   Transcript: ENSACAT00000012800
Sequence length 504
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343294.1:613870:802467:1 gene:ENSACAG00000012730 transcript:ENSACAT00000012800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGVSSNRTMSYSRWSYDSVLDDESSNLRQQKLDRQRALLEQKQKKKRQEPLMVQSNVDS
RARARRMKQSEEQAPLVESYLNSNSSTIYHVQEAEPEDVKVVADSQAPKSTKKTKAATGG
CQTGNTRQEKKGKHKGIDGPAAFQDDAKEVGSRVQILTVGEACQDEDDGEIIASCQQGKH
DLRVTMQKKGISSSMNFDEEEDEDDEDSSSSSQLNSNTRPGSATSKKSNKETASGPSPST
NNLVIDVDDLEEFGVRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAG
RKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGVNPMKTTLSLEASN
LRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHETLLSRWQNKNTESV
IELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDIFTMDY
NYPMCALQAFAIALSSFDSKLACE
Download sequence
Identical sequences H9GJ91
ENSACAP00000012544 XP_008115845.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]