SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012630 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012630
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-52
Family Ankyrin repeat 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012630   Gene: ENSACAG00000012813   Transcript: ENSACAT00000012886
Sequence length 228
Comment pep:novel chromosome:AnoCar2.0:5:28822080:28842646:1 gene:ENSACAG00000012813 transcript:ENSACAT00000012886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDVVIKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSRVNEQNNENETA
LHCAAQYGHSEVVAVLLDELTDPTIRNSKLETPLDLAALYGRLRVVKMIINAYPNLMSCN
TRKHTPLHLAARNGHKSVVQVLLEAGMDVSCQTEKGSALHEAALFGKVDVVRILLETGID
ANIKDSLGRTVLDILKEHPSQQSLQIAALLQDLEESPKEYINCRNRHV
Download sequence
Identical sequences G1KMW6
ENSACAP00000012630 ENSACAP00000012630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]