SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012638 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012638
Domain Number 1 Region: 32-156,259-492
Classification Level Classification E-value
Superfamily ARM repeat 1.02e-101
Family Diap1 N-terninal region-like 0.00082
Further Details:      
 
Domain Number 2 Region: 599-606,676-1047
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.88e-91
Family Formin homology 2 domain (FH2 domain) 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012638   Gene: ENSACAG00000012719   Transcript: ENSACAT00000012894
Sequence length 1130
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343296.1:1051750:1282751:-1 gene:ENSACAG00000012719 transcript:ENSACAT00000012894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAGSMDGQPADFRAPPGPPLKLPLPEPAELEERFNVVLNAMNLPPDKARLLRQYDSEK
KWELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHI
GWVREFLNEENKGLNVLVEYLSFAQYAVTFDFESLENNMENSMDKSKPWSRSIEDLHRGS
NLPSPVGSSISRSSRHSTLRMVCLPEKLQFKRRQSCFSPNCLWSGFSLPSAEEASSRKNS
YNTLPSRRALKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKN
PRTKALVLELLAAVCLVRGGHEIILSAFDHFKEVCGEKQRFEKLMEHFRNEDNNIDFMVA
CMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVG
ALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMAKIVELEKQLMQRNKELDVVRE
IYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGSIKIQKKGDGDINILPVGVA
SGTLSSGSDAVTTTVGGSVSGTTSSVALPPPPPPLPLSAEESEAVQNGPITTSMPPPPPP
PPPPPPPPPAPPLPGPAAEPVPAPPLPPPPPPSAPPLPGTASPTVVFNSGLADGPIKLFS
VKIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPA
IDLSSSKQITQKGSNKVTLLEANRAKNLAITLRKAGKTSDEICKAIQAFDLKTLPVDFVE
CLMRFLPMENEVKMLRLYERERKPLENLSDEDRFMMQFSKIERLMQKMTIMAFIGNFAES
IQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDT
KSTDRKQTLLHYISNVVRDKYQQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGLDLTK
REYTMHDHNTMLKEFIQINEGKLKKLQDDAKIAQDAFDDAVKYFGENPKTTPPSVFFPVF
VRFVKAYKQAEEENDLRKKQEQALMEKLLEQEALMEQQDQKSPSHKTKRQQQELIAELRR
RQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRILETSPTDEPMR
Download sequence
Identical sequences H9GJD2
ENSACAP00000012638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]